BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0215 (635 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48132| Best HMM Match : CLN3 (HMM E-Value=5.9e-09) 29 2.4 SB_31369| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 >SB_48132| Best HMM Match : CLN3 (HMM E-Value=5.9e-09) Length = 357 Score = 29.5 bits (63), Expect = 2.4 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = -3 Query: 531 TNTSRHSWTFHLEKLLSILYWLLVSY 454 T TS H W L ++L +L++LLVS+ Sbjct: 229 TPTSTHLWVLSLTEVLHLLFFLLVSW 254 >SB_31369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.5 bits (58), Expect = 9.7 Identities = 13/42 (30%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = +2 Query: 140 FA*NVEYWSR*IKHEYRLYKKNYHLFKKQ-RCNTAGPYNVIV 262 F + W R +K RL ++ Y +KK +CN+ G + + V Sbjct: 77 FQTKTDTWGRGLKPVLRLIRETYTYYKKHYQCNSNGKWKMTV 118 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,383,863 Number of Sequences: 59808 Number of extensions: 254236 Number of successful extensions: 568 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 474 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 567 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1596754500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -