BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0215 (635 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 26 1.1 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 23 8.1 AJ439353-5|CAD27927.1| 459|Anopheles gambiae putative G-protein... 23 8.1 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 25.8 bits (54), Expect = 1.1 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +2 Query: 185 YRLYKKNYHLFKKQRCNTAGPYNV 256 YRL KK YHL+ K+ + GP+ V Sbjct: 981 YRLVKKKYHLYVKK---STGPHAV 1001 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 23.0 bits (47), Expect = 8.1 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -3 Query: 168 LDQYSTFQANYIDLYDSLSKHINSLH 91 L +Y+ +A+Y+ L D +S NS H Sbjct: 344 LYRYNFAKADYVKLNDMISMFNNSFH 369 >AJ439353-5|CAD27927.1| 459|Anopheles gambiae putative G-protein coupled receptor protein. Length = 459 Score = 23.0 bits (47), Expect = 8.1 Identities = 10/41 (24%), Positives = 22/41 (53%) Frame = -3 Query: 576 FIPKKYQSTLNQNNATNTSRHSWTFHLEKLLSILYWLLVSY 454 ++P+ L Q +A + SW F + +L +++++L Y Sbjct: 372 YLPQISIILLQQLSAAMKLKLSWVFRVSDILILVHFMLDPY 412 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 553,542 Number of Sequences: 2352 Number of extensions: 11098 Number of successful extensions: 18 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 62305095 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -