BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0213 (629 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax pr... 25 0.52 EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B pro... 23 1.6 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 21 6.4 EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 21 8.5 >AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax protein. Length = 314 Score = 25.0 bits (52), Expect = 0.52 Identities = 12/44 (27%), Positives = 21/44 (47%) Frame = +3 Query: 231 YILSKHKHHDTRQRHLVTSPYRKKISSFVDYLNLKDQRSSTSCS 362 Y S+H HH + R SPY +++ + + Q++S S Sbjct: 48 YASSQHHHHHLQARPPQDSPYDASVAAACKLYSSEGQQNSNYSS 91 >EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B protein. Length = 279 Score = 23.4 bits (48), Expect = 1.6 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +1 Query: 394 ICSFFFYCLDG 426 IC F+YC+DG Sbjct: 121 ICDKFYYCVDG 131 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 21.4 bits (43), Expect = 6.4 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -2 Query: 154 PLIKIFLRFNLVFY 113 P +KIFL F +FY Sbjct: 488 PDVKIFLPFRFLFY 501 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 21.0 bits (42), Expect = 8.5 Identities = 6/8 (75%), Positives = 7/8 (87%) Frame = +1 Query: 397 CSFFFYCL 420 CS F+YCL Sbjct: 434 CSIFYYCL 441 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,157 Number of Sequences: 336 Number of extensions: 3787 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16188355 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -