BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0213 (629 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 22 5.7 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 22 5.7 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 5.7 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 21 7.5 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.8 bits (44), Expect = 5.7 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = +3 Query: 375 IKMCSYNMQLFLLLLRWVDGLTAHLVLNGY 464 +K +Y + +L W+ GL++ L + GY Sbjct: 517 VKYLTYEYPWWSHVLGWLCGLSSMLCIPGY 546 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.8 bits (44), Expect = 5.7 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = +3 Query: 375 IKMCSYNMQLFLLLLRWVDGLTAHLVLNGY 464 +K +Y + +L W+ GL++ L + GY Sbjct: 570 VKYLTYEYPWWSHVLGWLCGLSSMLCIPGY 599 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.8 bits (44), Expect = 5.7 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +1 Query: 193 HLSPNPKYNYPCV 231 HLSP+ NY CV Sbjct: 674 HLSPDHNGNYSCV 686 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.4 bits (43), Expect = 7.5 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +3 Query: 264 RQRHLVTSPYRKKISSFVDYLNLKDQR 344 +Q HL+ + +KK S+ + L L+ QR Sbjct: 159 QQTHLLQTADKKKASAPLQQLALQQQR 185 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 184,809 Number of Sequences: 438 Number of extensions: 4079 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18826962 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -