BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0211 (688 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein ... 52 2e-08 AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 28 0.32 L76038-1|AAC27383.1| 683|Anopheles gambiae prophenoloxidase pro... 26 1.3 AF031626-1|AAD01936.1| 683|Anopheles gambiae prophenoloxidase p... 26 1.3 AJ459962-1|CAD31061.1| 685|Anopheles gambiae prophenoloxidase 9... 25 3.0 AJ438610-7|CAD27479.1| 86|Anopheles gambiae hypothetical prote... 25 3.0 EF426240-1|ABO26483.1| 64|Anopheles gambiae unknown protein. 24 3.9 AY299455-1|AAQ73620.1| 493|Anopheles gambiae FMRF amide recepto... 24 3.9 EF426244-1|ABO26487.1| 64|Anopheles gambiae unknown protein. 23 6.8 EF426243-1|ABO26486.1| 64|Anopheles gambiae unknown protein. 23 6.8 EF426242-1|ABO26485.1| 64|Anopheles gambiae unknown protein. 23 6.8 EF426241-1|ABO26484.1| 64|Anopheles gambiae unknown protein. 23 6.8 EF426239-1|ABO26482.1| 64|Anopheles gambiae unknown protein. 23 6.8 EF426238-1|ABO26481.1| 64|Anopheles gambiae unknown protein. 23 6.8 EF426237-1|ABO26480.1| 64|Anopheles gambiae unknown protein. 23 6.8 EF426236-1|ABO26479.1| 64|Anopheles gambiae unknown protein. 23 6.8 EF426235-1|ABO26478.1| 64|Anopheles gambiae unknown protein. 23 6.8 EF426234-1|ABO26477.1| 64|Anopheles gambiae unknown protein. 23 6.8 EF426233-1|ABO26476.1| 64|Anopheles gambiae unknown protein. 23 6.8 EF426232-1|ABO26475.1| 64|Anopheles gambiae unknown protein. 23 6.8 EF426231-1|ABO26474.1| 64|Anopheles gambiae unknown protein. 23 6.8 EF426230-1|ABO26473.1| 64|Anopheles gambiae unknown protein. 23 6.8 EF426229-1|ABO26472.1| 64|Anopheles gambiae unknown protein. 23 6.8 EF426228-1|ABO26471.1| 64|Anopheles gambiae unknown protein. 23 6.8 EF426227-1|ABO26470.1| 64|Anopheles gambiae unknown protein. 23 6.8 EF426226-1|ABO26469.1| 64|Anopheles gambiae unknown protein. 23 6.8 EF426225-1|ABO26468.1| 64|Anopheles gambiae unknown protein. 23 6.8 >AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein protein. Length = 596 Score = 51.6 bits (118), Expect = 2e-08 Identities = 29/86 (33%), Positives = 42/86 (48%), Gaps = 4/86 (4%) Frame = +1 Query: 10 VREDIRQLESGVHVVVGTPGRVYDMITXRALHANTIKLFVLDEADEMLSRGFKDQIXXVF 189 V+ ++ + G HV+V TPGR+ D I + + VLDEAD ML GF I V Sbjct: 289 VQHQLQLMRGGCHVLVATPGRLLDFIDRGYVTFENVNFVVLDEADRMLDMGFLPSIEKVM 348 Query: 190 KMLS----ADVQVILLSATMPDDVLE 255 + Q ++ SAT P ++ E Sbjct: 349 GHATMPEKQQRQTLMFSATFPAEIQE 374 Score = 28.7 bits (61), Expect = 0.18 Identities = 16/56 (28%), Positives = 26/56 (46%) Frame = +3 Query: 414 VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDNVSVK*S*GSFVLGSSRVLITTDL 581 ++F T+R D+L M F +++HGD + + F G VLI T + Sbjct: 427 LVFVETKRNADYLASLMSETQFPTTSIHGDRLQREREMALYDFKSGRMDVLIATSV 482 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 27.9 bits (59), Expect = 0.32 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = +3 Query: 294 VQKEELTLEGIKQFYIAIELEEWKLETLCDLYDTLSIAQA-VIFCNTRRK 440 V+KE+L E IKQ+ + +E K TL + D + QA + N RRK Sbjct: 351 VEKEKLVKEEIKQYDELVSAKESKESTLKNSLDKFAKVQANMRATNERRK 400 >L76038-1|AAC27383.1| 683|Anopheles gambiae prophenoloxidase protein. Length = 683 Score = 25.8 bits (54), Expect = 1.3 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = -3 Query: 680 PNPGEYNFSRFGWPDHSL 627 P E+NF GWP H L Sbjct: 572 PQEAEFNFCGCGWPAHML 589 >AF031626-1|AAD01936.1| 683|Anopheles gambiae prophenoloxidase protein. Length = 683 Score = 25.8 bits (54), Expect = 1.3 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = -3 Query: 680 PNPGEYNFSRFGWPDHSL 627 P E+NF GWP H L Sbjct: 572 PQEAEFNFCGCGWPAHML 589 >AJ459962-1|CAD31061.1| 685|Anopheles gambiae prophenoloxidase 9 protein. Length = 685 Score = 24.6 bits (51), Expect = 3.0 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = -3 Query: 680 PNPGEYNFSRFGWPDHSL 627 P + F GWPDH L Sbjct: 571 PGTESFRFCNCGWPDHML 588 >AJ438610-7|CAD27479.1| 86|Anopheles gambiae hypothetical protein protein. Length = 86 Score = 24.6 bits (51), Expect = 3.0 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 485 ICYAWRHGQRERE 523 +C WRHGQR+ + Sbjct: 64 VCPVWRHGQRKHK 76 >EF426240-1|ABO26483.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 24.2 bits (50), Expect = 3.9 Identities = 6/11 (54%), Positives = 9/11 (81%) Frame = +2 Query: 44 FMWWWALQVVY 76 FMWWW L+ ++ Sbjct: 24 FMWWWVLRHLF 34 >AY299455-1|AAQ73620.1| 493|Anopheles gambiae FMRF amide receptor protein. Length = 493 Score = 24.2 bits (50), Expect = 3.9 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +1 Query: 439 RWIGSLNLCICVTLLYLLC 495 R IG + ICV +++LLC Sbjct: 305 REIGLATMLICVVIVFLLC 323 >EF426244-1|ABO26487.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.4 bits (48), Expect = 6.8 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +2 Query: 44 FMWWWAL 64 FMWWW L Sbjct: 24 FMWWWVL 30 >EF426243-1|ABO26486.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.4 bits (48), Expect = 6.8 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +2 Query: 44 FMWWWAL 64 FMWWW L Sbjct: 24 FMWWWVL 30 >EF426242-1|ABO26485.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.4 bits (48), Expect = 6.8 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +2 Query: 44 FMWWWAL 64 FMWWW L Sbjct: 24 FMWWWVL 30 >EF426241-1|ABO26484.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.4 bits (48), Expect = 6.8 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +2 Query: 44 FMWWWAL 64 FMWWW L Sbjct: 24 FMWWWVL 30 >EF426239-1|ABO26482.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.4 bits (48), Expect = 6.8 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +2 Query: 44 FMWWWAL 64 FMWWW L Sbjct: 24 FMWWWVL 30 >EF426238-1|ABO26481.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.4 bits (48), Expect = 6.8 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +2 Query: 44 FMWWWAL 64 FMWWW L Sbjct: 24 FMWWWVL 30 >EF426237-1|ABO26480.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.4 bits (48), Expect = 6.8 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +2 Query: 44 FMWWWAL 64 FMWWW L Sbjct: 24 FMWWWVL 30 >EF426236-1|ABO26479.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.4 bits (48), Expect = 6.8 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +2 Query: 44 FMWWWAL 64 FMWWW L Sbjct: 24 FMWWWVL 30 >EF426235-1|ABO26478.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.4 bits (48), Expect = 6.8 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +2 Query: 44 FMWWWAL 64 FMWWW L Sbjct: 24 FMWWWVL 30 >EF426234-1|ABO26477.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.4 bits (48), Expect = 6.8 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +2 Query: 44 FMWWWAL 64 FMWWW L Sbjct: 24 FMWWWVL 30 >EF426233-1|ABO26476.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.4 bits (48), Expect = 6.8 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +2 Query: 44 FMWWWAL 64 FMWWW L Sbjct: 24 FMWWWVL 30 >EF426232-1|ABO26475.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.4 bits (48), Expect = 6.8 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +2 Query: 44 FMWWWAL 64 FMWWW L Sbjct: 24 FMWWWVL 30 >EF426231-1|ABO26474.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.4 bits (48), Expect = 6.8 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +2 Query: 44 FMWWWAL 64 FMWWW L Sbjct: 24 FMWWWVL 30 >EF426230-1|ABO26473.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.4 bits (48), Expect = 6.8 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +2 Query: 44 FMWWWAL 64 FMWWW L Sbjct: 24 FMWWWVL 30 >EF426229-1|ABO26472.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.4 bits (48), Expect = 6.8 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +2 Query: 44 FMWWWAL 64 FMWWW L Sbjct: 24 FMWWWVL 30 >EF426228-1|ABO26471.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.4 bits (48), Expect = 6.8 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +2 Query: 44 FMWWWAL 64 FMWWW L Sbjct: 24 FMWWWVL 30 >EF426227-1|ABO26470.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.4 bits (48), Expect = 6.8 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +2 Query: 44 FMWWWAL 64 FMWWW L Sbjct: 24 FMWWWVL 30 >EF426226-1|ABO26469.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.4 bits (48), Expect = 6.8 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +2 Query: 44 FMWWWAL 64 FMWWW L Sbjct: 24 FMWWWVL 30 >EF426225-1|ABO26468.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.4 bits (48), Expect = 6.8 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +2 Query: 44 FMWWWAL 64 FMWWW L Sbjct: 24 FMWWWVL 30 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 799,337 Number of Sequences: 2352 Number of extensions: 15737 Number of successful extensions: 49 Number of sequences better than 10.0: 27 Number of HSP's better than 10.0 without gapping: 46 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 49 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69413730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -