BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0209 (626 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0201 + 15456805-15457154,15457246-15457450,15457959-15457994 28 5.3 12_01_0229 + 1731288-1732513,1733037-1733106,1733267-1734001 27 9.2 >12_02_0201 + 15456805-15457154,15457246-15457450,15457959-15457994 Length = 196 Score = 28.3 bits (60), Expect = 5.3 Identities = 11/51 (21%), Positives = 26/51 (50%) Frame = -1 Query: 437 VLNLSKIISLIRLQS*YRHCDCIYTFHIQLHYNLHSNNSLIEYIINKKQFI 285 ++ L+ + +++ + Y CDC ++LHY LH + + ++F+ Sbjct: 9 IIILAMLPAILTMADPYCDCDCPQQCEVKLHYYLHQFRAGANHPNRNEEFV 59 >12_01_0229 + 1731288-1732513,1733037-1733106,1733267-1734001 Length = 676 Score = 27.5 bits (58), Expect = 9.2 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -1 Query: 95 FCCLAYRSGFEAIEAIDDNDGGGESAASS 9 + C+ ++G A+ DD+D GG AAS+ Sbjct: 548 YICVRAKAGAAAVLLADDDDDGGAPAASA 576 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,544,145 Number of Sequences: 37544 Number of extensions: 207029 Number of successful extensions: 460 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 449 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 458 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1525730988 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -