BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0209 (626 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_31348| Best HMM Match : ERM (HMM E-Value=0) 29 2.3 SB_21580| Best HMM Match : Flotillin (HMM E-Value=0) 27 9.4 >SB_31348| Best HMM Match : ERM (HMM E-Value=0) Length = 665 Score = 29.5 bits (63), Expect = 2.3 Identities = 14/28 (50%), Positives = 17/28 (60%), Gaps = 2/28 (7%) Frame = +1 Query: 511 TGCRCRILLAQ-CGNCDM-F*YYFCNKC 588 T C L+Q C NC+ F +YFCNKC Sbjct: 519 TNCHVDQELSQHCTNCEKKFAFYFCNKC 546 >SB_21580| Best HMM Match : Flotillin (HMM E-Value=0) Length = 393 Score = 27.5 bits (58), Expect = 9.4 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = -1 Query: 452 IESLKVLNLSKIISLIRLQS*YRHCDCIYTFHIQ 351 +E L N K + L +LQS Y HC C + F+++ Sbjct: 242 LEKLAEANRHKQLILAQLQSCYSHC-CTFLFYME 274 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,447,059 Number of Sequences: 59808 Number of extensions: 267759 Number of successful extensions: 483 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 410 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 481 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1560464625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -