Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= prgv0207
         (613 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF592539-1|ABQ95985.1|  630|Tribolium castaneum beta-N-acetylglu...    22   3.5  
AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory recept...    22   4.7  

>EF592539-1|ABQ95985.1|  630|Tribolium castaneum
           beta-N-acetylglucosaminidase FDL protein.
          Length = 630

 Score = 22.2 bits (45), Expect = 3.5
 Identities = 12/31 (38%), Positives = 20/31 (64%)
 Frame = -1

Query: 226 FNTFLIICYEKWLVFKQSTSNLTTGTVVATF 134
           F +F  I +  +L ++Q TSNLTT  ++ T+
Sbjct: 12  FFSFCCILFFIYLYWQQ-TSNLTTSKLLYTY 41


>AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory receptor
           candidate 19 protein.
          Length = 355

 Score = 21.8 bits (44), Expect = 4.7
 Identities = 6/11 (54%), Positives = 11/11 (100%)
 Frame = -2

Query: 393 VVVIIICIHYF 361
           V++I++CI+YF
Sbjct: 231 VLIILLCIYYF 241


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 126,651
Number of Sequences: 336
Number of extensions: 2573
Number of successful extensions: 3
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 15561709
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)