BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0207 (613 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_20457| Best HMM Match : fn3 (HMM E-Value=5.1e-12) 28 5.2 SB_53560| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 >SB_20457| Best HMM Match : fn3 (HMM E-Value=5.1e-12) Length = 1114 Score = 28.3 bits (60), Expect = 5.2 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -2 Query: 519 KRFVPPTRSCHITYAQTAFEKCYL 448 K F PP+ +CH Y+ F+ C L Sbjct: 934 KAFTPPSLTCHYLYSYRTFQCCDL 957 >SB_53560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 27.5 bits (58), Expect = 9.1 Identities = 19/78 (24%), Positives = 36/78 (46%), Gaps = 1/78 (1%) Frame = -1 Query: 457 MLLKTVRFESKSCNIPFTGSVSSSNNYL-HTLF*RFKCLITNIASSSVTILRLI*LIKMG 281 ++ +T +E I + ++ + + H F FKC I ++ + S + + K Sbjct: 11 VVCRTCVYEKLESKIEYLNALQTKPTLVSHMDFLCFKCTIIHLNALSFLRIERLNTKKTW 70 Query: 280 IQRLNIRYIILFFKF*AN 227 I+RLN + + LF F N Sbjct: 71 IERLNPKSLALFLGFLTN 88 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,319,072 Number of Sequences: 59808 Number of extensions: 272120 Number of successful extensions: 564 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 494 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 564 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1499981500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -