BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0205 (563 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. 22 3.2 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 22 3.2 AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain tran... 22 4.2 AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia or... 22 4.2 DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired pr... 21 9.6 >AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. Length = 209 Score = 22.2 bits (45), Expect = 3.2 Identities = 13/34 (38%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = +1 Query: 22 PPNFSRSFGTPFNKTYRQ--GPQPFVQQKAYPQT 117 PP+ S S+G P N R P P Q A Q+ Sbjct: 74 PPSSSLSYGGPVNDDVRSPGTPGPLSQAPASQQS 107 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 22.2 bits (45), Expect = 3.2 Identities = 13/34 (38%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = +1 Query: 22 PPNFSRSFGTPFNKTYRQ--GPQPFVQQKAYPQT 117 PP+ S S+G P N R P P Q A Q+ Sbjct: 230 PPSSSLSYGGPVNDDVRSPGTPGPLSQAPASQQS 263 >AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain transcription factor Maxillopediaprotein. Length = 523 Score = 21.8 bits (44), Expect = 4.2 Identities = 8/33 (24%), Positives = 16/33 (48%) Frame = +1 Query: 82 QPFVQQKAYPQTAFARGASPQRSQSPKPTDEHF 180 QP+V+ P AR + ++ P P +++ Sbjct: 328 QPYVRNTTVPTQGVARMSRGRQYNYPNPQQQYY 360 >AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia ortholog protein. Length = 471 Score = 21.8 bits (44), Expect = 4.2 Identities = 8/33 (24%), Positives = 16/33 (48%) Frame = +1 Query: 82 QPFVQQKAYPQTAFARGASPQRSQSPKPTDEHF 180 QP+V+ P AR + ++ P P +++ Sbjct: 276 QPYVRNTTVPTQGVARMSRGRQYNYPNPQQQYY 308 >DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired protein. Length = 311 Score = 20.6 bits (41), Expect = 9.6 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +1 Query: 178 FVKVPVHHETP 210 FVKVP H++ P Sbjct: 141 FVKVPRHYDDP 151 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 114,562 Number of Sequences: 336 Number of extensions: 2306 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 13890653 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -