BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0204 (612 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 31 0.56 SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.74 SB_49249| Best HMM Match : RRM_1 (HMM E-Value=0.00042) 31 0.97 SB_46036| Best HMM Match : PSRT (HMM E-Value=1) 31 0.97 SB_2029| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_52319| Best HMM Match : Rho_N (HMM E-Value=1.8e-07) 30 1.7 SB_23612| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_51724| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_3464| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_37346| Best HMM Match : Extensin_2 (HMM E-Value=0.62) 29 3.9 SB_20395| Best HMM Match : Extensin_2 (HMM E-Value=0.019) 29 3.9 SB_40685| Best HMM Match : NPIP (HMM E-Value=1.8) 28 5.2 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.2 SB_17329| Best HMM Match : S-antigen (HMM E-Value=0.31) 28 5.2 SB_9594| Best HMM Match : Extensin_2 (HMM E-Value=0.066) 28 5.2 SB_20856| Best HMM Match : Transposase_11 (HMM E-Value=2.3) 28 5.2 SB_10451| Best HMM Match : Extensin_2 (HMM E-Value=3.6) 28 5.2 SB_50550| Best HMM Match : RVT_1 (HMM E-Value=7.5e-28) 28 6.9 SB_39596| Best HMM Match : TTL (HMM E-Value=0) 28 6.9 SB_39421| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_33430| Best HMM Match : RVT_1 (HMM E-Value=1.3e-26) 28 6.9 SB_29231| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_28387| Best HMM Match : RVT_1 (HMM E-Value=0.0013) 28 6.9 SB_26467| Best HMM Match : PKD (HMM E-Value=1.1e-06) 28 6.9 SB_20635| Best HMM Match : rve (HMM E-Value=0.91) 28 6.9 SB_11571| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_6920| Best HMM Match : RVT_1 (HMM E-Value=2.7e-06) 28 6.9 SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) 28 6.9 SB_54962| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_47528| Best HMM Match : RVT_1 (HMM E-Value=9.9e-16) 28 6.9 SB_43394| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_31165| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_16359| Best HMM Match : RVT_1 (HMM E-Value=0.00049) 28 6.9 SB_9990| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_44575| Best HMM Match : DUF444 (HMM E-Value=0.84) 27 9.1 SB_35197| Best HMM Match : SAP (HMM E-Value=3.2) 27 9.1 SB_15551| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_52277| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_23539| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 24 9.7 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 31.5 bits (68), Expect = 0.56 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -3 Query: 115 PSRLGASTPPPPPFAQSRCSTSPYRG 38 P+R+G + PPPPP S+ P RG Sbjct: 319 PARMGTAPPPPPPSRSSQRPPPPSRG 344 >SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1272 Score = 31.1 bits (67), Expect = 0.74 Identities = 23/75 (30%), Positives = 34/75 (45%), Gaps = 1/75 (1%) Frame = -3 Query: 244 DDFRPQLPPWDSCSRNGASTSTPRKAQRCSSKGVA-LRTPR*ASPSRLGASTPPPPPFAQ 68 D P PP R S S PR+ +R S +R+ P R ASTPP P A+ Sbjct: 911 DSPTPSPPP--RRRRKSPSPSPPRRRRRSPSNSPPPMRSSPLPPPQRKRASTPPSPRRAR 968 Query: 67 SRCSTSPYRGPRRSN 23 + ++ + ++SN Sbjct: 969 RKVASPEEQDRQKSN 983 Score = 31.1 bits (67), Expect = 0.74 Identities = 22/80 (27%), Positives = 36/80 (45%), Gaps = 3/80 (3%) Frame = -3 Query: 235 RPQLPPWDSCSRNGASTSTPRKAQRCSSKGVALRTPR*ASPSRLGASTPPPP---PFAQS 65 RP+ P S+S PR+++ + RTP SR +P PP P +S Sbjct: 1044 RPRKRPRHQSRERRPSSSPPRRSRPQRTSPSPRRTPEDRRRSRGSRRSPSPPKREPRRRS 1103 Query: 64 RCSTSPYRGPRRSNI*ASPR 5 ++ P R R+ ++ SP+ Sbjct: 1104 PSASPPRREARKRSLSRSPK 1123 >SB_49249| Best HMM Match : RRM_1 (HMM E-Value=0.00042) Length = 792 Score = 30.7 bits (66), Expect = 0.97 Identities = 13/24 (54%), Positives = 16/24 (66%), Gaps = 2/24 (8%) Frame = -1 Query: 93 HPR--PRRSPNHDVRPAHTVGPEG 28 HPR P RS + D+RP H +GP G Sbjct: 288 HPRMDPPRSMSSDIRPMHDMGPRG 311 >SB_46036| Best HMM Match : PSRT (HMM E-Value=1) Length = 878 Score = 30.7 bits (66), Expect = 0.97 Identities = 22/53 (41%), Positives = 26/53 (49%), Gaps = 3/53 (5%) Frame = -2 Query: 191 IDINPTKSTAVL---FKRGRPPNTTLSIPLPTRRVNTPAPAVRPITMFDQPIP 42 ID P S AV R R N+T +P TRRV +P AVRP + Q P Sbjct: 483 IDSKPRPSPAVREAEMGRSRRDNSTSPLPRQTRRV-SPTQAVRPSSTQGQSAP 534 >SB_2029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 350 Score = 30.3 bits (65), Expect = 1.3 Identities = 12/39 (30%), Positives = 25/39 (64%), Gaps = 1/39 (2%) Frame = +3 Query: 150 FEEHRCAFRG-VDVDAPFREQLSHGGSCGLKSSMKQAFF 263 ++E R F G +++DA R L+HGGS ++ ++++ + Sbjct: 30 YKELRGLFEGDIEIDASTRHALTHGGSIDVRDALRRPIY 68 >SB_52319| Best HMM Match : Rho_N (HMM E-Value=1.8e-07) Length = 1458 Score = 29.9 bits (64), Expect = 1.7 Identities = 19/61 (31%), Positives = 29/61 (47%) Frame = -2 Query: 212 QLFPKWRIDINPTKSTAVLFKRGRPPNTTLSIPLPTRRVNTPAPAVRPITMFDQPIPWAP 33 +L P + + P K+ R P+ S+P+PT R N P P +PI + IP P Sbjct: 67 KLRPPTVLIVRPLKTGTT--PRKNIPDQERSLPIPTPRRNIPYPQPKPIPTPRKNIPNQP 124 Query: 32 K 30 + Sbjct: 125 Q 125 >SB_23612| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1021 Score = 29.9 bits (64), Expect = 1.7 Identities = 21/66 (31%), Positives = 30/66 (45%), Gaps = 1/66 (1%) Frame = -3 Query: 232 PQLPPWDSCSRNGASTSTPRKAQRCSSKGVALRTPR*ASPSRLGAST-PPPPPFAQSRCS 56 P P S++ PR+ QR + T + S LG+S PPPP+ SR S Sbjct: 719 PGFPQQQQPSQSQQQQFFPRQ-QRMMTTTAHSPTAQSPSADSLGSSVRSPPPPYPGSRTS 777 Query: 55 TSPYRG 38 +P+ G Sbjct: 778 GNPHMG 783 >SB_51724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 45 Score = 29.5 bits (63), Expect = 2.2 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -3 Query: 115 PSRLGASTPPPPPFAQSRC 59 P+ LGAS PPPP A +C Sbjct: 21 PTPLGASAPPPPKSADRKC 39 >SB_3464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1462 Score = 29.1 bits (62), Expect = 3.0 Identities = 20/47 (42%), Positives = 25/47 (53%), Gaps = 2/47 (4%) Frame = -3 Query: 349 RGYFSFGPRSPETHLALFADDTAIYYSGRKKACFI--DDFRPQLPPW 215 RGY + P +HL LF+D+ Y SG K+ FI DD R L W Sbjct: 595 RGYDTAADEYP-SHLNLFSDEVGTYSSG-KQVGFIRNDDHRGVLVCW 639 >SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 29.1 bits (62), Expect = 3.0 Identities = 21/61 (34%), Positives = 29/61 (47%), Gaps = 6/61 (9%) Frame = -3 Query: 232 PQLPPWDSCSRNGASTS-TPRKAQRCSS----KGVALRTP-R*ASPSRLGASTPPPPPFA 71 P LPP + S RK R +S + + L++P R PS + A PPPPP A Sbjct: 797 PHLPPAPNISAEPPPPPPVARKPSRSNSTSSQRSLELQSPSREEGPSLITAEPPPPPPVA 856 Query: 70 Q 68 + Sbjct: 857 R 857 >SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2143 Score = 28.7 bits (61), Expect = 3.9 Identities = 17/55 (30%), Positives = 23/55 (41%) Frame = -3 Query: 211 SCSRNGASTSTPRKAQRCSSKGVALRTPR*ASPSRLGASTPPPPPFAQSRCSTSP 47 S S + +S T KA+ CS+ P S A PPPPP + + P Sbjct: 544 SPSTSTSSVGTLNKAEHCSASADLPLPPPEFSDLESSAPIPPPPPQMNNTSAPPP 598 >SB_37346| Best HMM Match : Extensin_2 (HMM E-Value=0.62) Length = 331 Score = 28.7 bits (61), Expect = 3.9 Identities = 20/72 (27%), Positives = 27/72 (37%) Frame = -3 Query: 235 RPQLPPWDSCSRNGASTSTPRKAQRCSSKGVALRTPR*ASPSRLGASTPPPPPFAQSRCS 56 + Q+PPW ST +C SK P +P + T P P F R Sbjct: 58 KSQIPPWTRARSPVDSTRAKSPRGQCQSK-----VPPWTAPEQDPPWTVPKPDFLIDRAK 112 Query: 55 TSPYRGPRRSNI 20 + G R+S I Sbjct: 113 ARYHGGKRQSQI 124 >SB_20395| Best HMM Match : Extensin_2 (HMM E-Value=0.019) Length = 348 Score = 28.7 bits (61), Expect = 3.9 Identities = 20/72 (27%), Positives = 27/72 (37%) Frame = -3 Query: 235 RPQLPPWDSCSRNGASTSTPRKAQRCSSKGVALRTPR*ASPSRLGASTPPPPPFAQSRCS 56 + Q+PPW ST +C SK P +P + T P P F R Sbjct: 215 KSQIPPWTRARSPVDSTRAKSPRGQCQSK-----VPPWTAPEQDPPWTVPKPDFLIDRAK 269 Query: 55 TSPYRGPRRSNI 20 + G R+S I Sbjct: 270 ARYHGGKRQSQI 281 >SB_40685| Best HMM Match : NPIP (HMM E-Value=1.8) Length = 672 Score = 28.3 bits (60), Expect = 5.2 Identities = 20/43 (46%), Positives = 24/43 (55%) Frame = -3 Query: 205 SRNGASTSTPRKAQRCSSKGVALRTPR*ASPSRLGASTPPPPP 77 SR+ S + P K +R S +R PR SPSRLG ST P P Sbjct: 514 SRDFGSFTRP-KPRRSKSP---VRRPRSVSPSRLGNSTVEPLP 552 >SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1887 Score = 28.3 bits (60), Expect = 5.2 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = -3 Query: 214 DSCSRNGASTSTP-RKAQRCSSKGVALRTPR*ASPSRLGASTPPPPPFAQS 65 +SCS+N + + +C S G L+ + + ASTPPPPP S Sbjct: 616 ESCSQNDCLSDLECDEGSKCCSDGCKLKCVQ----LKRQASTPPPPPTTSS 662 >SB_17329| Best HMM Match : S-antigen (HMM E-Value=0.31) Length = 646 Score = 28.3 bits (60), Expect = 5.2 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +3 Query: 138 RATPFEEHRCAFRGVDVDAPFREQLSHG 221 + + F HRC F G+D++ E S+G Sbjct: 208 KCSSFSSHRCPFPGIDIEGADDEMESNG 235 >SB_9594| Best HMM Match : Extensin_2 (HMM E-Value=0.066) Length = 361 Score = 28.3 bits (60), Expect = 5.2 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -2 Query: 140 PPNTTLSIPLPTRRVNTPA 84 PPNT +P PT+ ++TPA Sbjct: 337 PPNTVHPLPFPTKYLSTPA 355 >SB_20856| Best HMM Match : Transposase_11 (HMM E-Value=2.3) Length = 449 Score = 28.3 bits (60), Expect = 5.2 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = -3 Query: 349 RGYFSFGPRSPETHLALFADDTAIYYSGRK 260 RGY + SP +HL LF+D+ Y+SG++ Sbjct: 230 RGYDTARDESP-SHLNLFSDEGGTYHSGKQ 258 >SB_10451| Best HMM Match : Extensin_2 (HMM E-Value=3.6) Length = 493 Score = 28.3 bits (60), Expect = 5.2 Identities = 19/54 (35%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Frame = -3 Query: 193 ASTSTPRKAQRCSSKGVAL--RTPR*ASPSRLGASTPPPPPFAQSRCSTSPYRG 38 A+ TP ++R SS + TPR + SR G PP Q +C+T RG Sbjct: 393 AAAGTPAGSRRSSSSSRSSLPSTPRSRTSSR-GQEVVSKPPRPQKKCTTRKSRG 445 >SB_50550| Best HMM Match : RVT_1 (HMM E-Value=7.5e-28) Length = 434 Score = 27.9 bits (59), Expect = 6.9 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -3 Query: 328 PRSPETHLALFADDTAIYYSGR 263 P S T L+++ADD IY+ GR Sbjct: 219 PMSVNTELSMYADDHQIYHCGR 240 >SB_39596| Best HMM Match : TTL (HMM E-Value=0) Length = 808 Score = 27.9 bits (59), Expect = 6.9 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -3 Query: 328 PRSPETHLALFADDTAIYYSGR 263 P S T L+++ADD IY+ GR Sbjct: 91 PMSVNTELSMYADDHQIYHCGR 112 >SB_39421| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1810 Score = 27.9 bits (59), Expect = 6.9 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = -2 Query: 179 PTKSTAVLFKRGRPPNTTLSIPLPTRRVNTPAPAVRPIT 63 PT ST +L + + S+PLP + + P +RP T Sbjct: 479 PTSSTGILSTQHACDAPSESVPLPQHQYSLPDERLRPFT 517 >SB_33430| Best HMM Match : RVT_1 (HMM E-Value=1.3e-26) Length = 288 Score = 27.9 bits (59), Expect = 6.9 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -3 Query: 328 PRSPETHLALFADDTAIYYSGR 263 P S T L+++ADD IY+ GR Sbjct: 172 PMSVNTELSMYADDHQIYHCGR 193 >SB_29231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2271 Score = 27.9 bits (59), Expect = 6.9 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -3 Query: 328 PRSPETHLALFADDTAIYYSGR 263 P S T L+++ADD IY+ GR Sbjct: 2154 PMSVNTELSMYADDHQIYHCGR 2175 >SB_28387| Best HMM Match : RVT_1 (HMM E-Value=0.0013) Length = 220 Score = 27.9 bits (59), Expect = 6.9 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -3 Query: 328 PRSPETHLALFADDTAIYYSGR 263 P S T L+++ADD IY+ GR Sbjct: 172 PMSVNTELSMYADDHQIYHCGR 193 >SB_26467| Best HMM Match : PKD (HMM E-Value=1.1e-06) Length = 1826 Score = 27.9 bits (59), Expect = 6.9 Identities = 17/70 (24%), Positives = 28/70 (40%) Frame = -3 Query: 229 QLPPWDSCSRNGASTSTPRKAQRCSSKGVALRTPR*ASPSRLGASTPPPPPFAQSRCSTS 50 ++PP + S + T TP + +R G R S + PPP P + + Sbjct: 1465 EIPPTEDPSTDAVPTDTPSRKKRAIPAGCKDHNGR-MKRSCVFIPPPPPKPTTPPKHGSG 1523 Query: 49 PYRGPRRSNI 20 + G R N+ Sbjct: 1524 GFAGYRAPNL 1533 >SB_20635| Best HMM Match : rve (HMM E-Value=0.91) Length = 748 Score = 27.9 bits (59), Expect = 6.9 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -2 Query: 140 PPNTTLSIPLPTRRVNTPAPAV 75 PPNTT P T R+ T AP V Sbjct: 336 PPNTTQQPPATTTRMKTDAPGV 357 >SB_11571| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 469 Score = 27.9 bits (59), Expect = 6.9 Identities = 12/36 (33%), Positives = 15/36 (41%) Frame = -2 Query: 140 PPNTTLSIPLPTRRVNTPAPAVRPITMFDQPIPWAP 33 P NT + P + NTP P P + P P P Sbjct: 60 PSNTPQQLTTPPHQSNTPRPLTPPSRQSNNPRPHTP 95 >SB_6920| Best HMM Match : RVT_1 (HMM E-Value=2.7e-06) Length = 250 Score = 27.9 bits (59), Expect = 6.9 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -3 Query: 328 PRSPETHLALFADDTAIYYSGR 263 P S T L+++ADD IY+ GR Sbjct: 134 PMSVNTELSMYADDHQIYHCGR 155 >SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) Length = 546 Score = 27.9 bits (59), Expect = 6.9 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -3 Query: 328 PRSPETHLALFADDTAIYYSGR 263 P S T L+++ADD IY+ GR Sbjct: 490 PMSVNTELSMYADDHQIYHCGR 511 >SB_54962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2211 Score = 27.9 bits (59), Expect = 6.9 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -3 Query: 328 PRSPETHLALFADDTAIYYSGR 263 P S T L+++ADD IY+ GR Sbjct: 882 PMSVNTELSMYADDHQIYHCGR 903 >SB_47528| Best HMM Match : RVT_1 (HMM E-Value=9.9e-16) Length = 228 Score = 27.9 bits (59), Expect = 6.9 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -3 Query: 328 PRSPETHLALFADDTAIYYSGR 263 P S T L+++ADD IY+ GR Sbjct: 172 PMSVNTELSMYADDHQIYHCGR 193 >SB_43394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 27.9 bits (59), Expect = 6.9 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -3 Query: 328 PRSPETHLALFADDTAIYYSGR 263 P S T L+++ADD IY+ GR Sbjct: 37 PMSVNTELSMYADDHQIYHCGR 58 >SB_31165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 27.9 bits (59), Expect = 6.9 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -3 Query: 328 PRSPETHLALFADDTAIYYSGR 263 P S T L+++ADD IY+ GR Sbjct: 34 PMSVNTELSMYADDHQIYHCGR 55 >SB_16359| Best HMM Match : RVT_1 (HMM E-Value=0.00049) Length = 220 Score = 27.9 bits (59), Expect = 6.9 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -3 Query: 328 PRSPETHLALFADDTAIYYSGR 263 P S T L+++ADD IY+ GR Sbjct: 172 PMSVNTELSMYADDHQIYHCGR 193 >SB_9990| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 288 Score = 27.9 bits (59), Expect = 6.9 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -3 Query: 328 PRSPETHLALFADDTAIYYSGR 263 P S T L+++ADD IY+ GR Sbjct: 172 PMSVNTELSMYADDHQIYHCGR 193 >SB_44575| Best HMM Match : DUF444 (HMM E-Value=0.84) Length = 451 Score = 27.5 bits (58), Expect = 9.1 Identities = 15/42 (35%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = -1 Query: 339 SASAPGLRRPI-WRSSPMTPPSTTRVGRRLASSTTSDRSYHH 217 S + P R+ + WRS PM P + G L S SY H Sbjct: 216 SCANPKCRKEMSWRSQPMMPGTKVAAGNFLLSYAILVASYEH 257 >SB_35197| Best HMM Match : SAP (HMM E-Value=3.2) Length = 323 Score = 27.5 bits (58), Expect = 9.1 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = -1 Query: 249 SSTTSDRSYHHGTVVPEMAHRHQPHEK 169 SS++S S+HH + HRH P + Sbjct: 96 SSSSSSSSHHHHQQQQQQQHRHHPRHR 122 >SB_15551| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.5 bits (58), Expect = 9.1 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 Query: 91 PPPPPFAQSRCSTSPYRGPR 32 P P P + R +TSPYR P+ Sbjct: 101 PYPTPTSPQRATTSPYRAPK 120 >SB_52277| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 27.5 bits (58), Expect = 9.1 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 Query: 91 PPPPPFAQSRCSTSPYRGPR 32 P P P + R +TSPYR P+ Sbjct: 75 PYPTPTSPQRATTSPYRAPK 94 >SB_23539| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1041 Score = 27.5 bits (58), Expect = 9.1 Identities = 12/53 (22%), Positives = 23/53 (43%) Frame = -1 Query: 306 WRSSPMTPPSTTRVGRRLASSTTSDRSYHHGTVVPEMAHRHQPHEKHSGALQK 148 W+ + T + + A +TT+ R H + Q H+KHS +++ Sbjct: 144 WQKTRQTIGKKKKHDKHSAKNTTNTRQKHDKHSAKNTTNTRQKHDKHSAKIRQ 196 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 23.8 bits (49), Expect(2) = 9.7 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -3 Query: 103 GASTPPPPPF 74 GA PPPPPF Sbjct: 209 GAPPPPPPPF 218 Score = 21.8 bits (44), Expect(2) = 9.7 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = -3 Query: 115 PSRLGASTPPPPP 77 PS + PPPPP Sbjct: 188 PSPMAGMPPPPPP 200 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,340,770 Number of Sequences: 59808 Number of extensions: 461221 Number of successful extensions: 2200 Number of sequences better than 10.0: 42 Number of HSP's better than 10.0 without gapping: 1854 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2170 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1499981500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -