BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0204 (612 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g70895.1 68414.m08180 CLE17, putative CLAVATA3/ESR-Related 17... 35 0.037 At1g16610.2 68414.m01990 arginine/serine-rich protein, putative ... 33 0.15 At1g16610.1 68414.m01989 arginine/serine-rich protein, putative ... 33 0.15 At2g37100.1 68415.m04552 protamine P1 family protein contains Pf... 31 0.46 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 31 0.60 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 31 0.60 At1g08170.1 68414.m00902 histone H2B family protein similar to h... 30 1.1 At4g27520.1 68417.m03952 plastocyanin-like domain-containing pro... 30 1.4 At2g40116.1 68415.m04933 phosphoinositide-specific phospholipase... 30 1.4 At4g17940.1 68417.m02672 expressed protein 29 1.8 At3g24540.1 68416.m03082 protein kinase family protein contains ... 29 1.8 At2g33690.1 68415.m04129 late embryogenesis abundant protein, pu... 29 1.8 At5g55020.1 68418.m06853 myb family transcription factor (MYB120... 29 2.4 At5g07820.1 68418.m00896 expressed protein 28 4.2 At4g31580.1 68417.m04485 splicing factor RSZp22 (RSZP22) / 9G8-l... 28 4.2 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 28 4.2 At2g35640.1 68415.m04371 hydroxyproline-rich glycoprotein family... 28 4.2 At1g62870.1 68414.m07099 expressed protein 28 4.2 At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family... 25 4.6 At5g65630.1 68418.m08256 DNA-binding bromodomain-containing prot... 28 5.6 At3g29800.1 68416.m03792 AAA-type ATPase family contains Pfam pr... 28 5.6 At2g23120.1 68415.m02758 expressed protein 28 5.6 At2g11090.1 68415.m01187 expressed protein 28 5.6 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 27 7.4 At2g17450.1 68415.m02014 zinc finger (C3HC4-type RING finger) fa... 27 7.4 At1g42740.1 68414.m04939 hypothetical protein 27 7.4 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 27 7.4 At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 23 8.3 At5g32161.1 68418.m03792 hypothetical protein 27 9.8 At5g07770.1 68418.m00889 formin homology 2 domain-containing pro... 27 9.8 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 27 9.8 At2g34670.1 68415.m04259 proline-rich family protein contains pr... 27 9.8 At1g70640.1 68414.m08143 octicosapeptide/Phox/Bem1p (PB1) domain... 27 9.8 At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibit... 27 9.8 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 27 9.8 At1g26150.1 68414.m03192 protein kinase family protein similar t... 27 9.8 At2g25050.1 68415.m02996 formin homology 2 domain-containing pro... 24 9.9 >At1g70895.1 68414.m08180 CLE17, putative CLAVATA3/ESR-Related 17 (CLE17) Length = 99 Score = 35.1 bits (77), Expect = 0.037 Identities = 15/24 (62%), Positives = 17/24 (70%) Frame = -3 Query: 106 LGASTPPPPPFAQSRCSTSPYRGP 35 L AS PPPPP R ST+P+RGP Sbjct: 53 LVASPPPPPPRKALRYSTAPFRGP 76 >At1g16610.2 68414.m01990 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 407 Score = 33.1 bits (72), Expect = 0.15 Identities = 17/44 (38%), Positives = 25/44 (56%) Frame = -3 Query: 211 SCSRNGASTSTPRKAQRCSSKGVALRTPR*ASPSRLGASTPPPP 80 S SR+ +S+S+P ++ S+ R A P+R G S PPPP Sbjct: 39 SRSRSLSSSSSPSRSVSSGSRSPPRRGKSPAGPARRGRSPPPPP 82 Score = 31.1 bits (67), Expect = 0.60 Identities = 18/45 (40%), Positives = 22/45 (48%) Frame = -3 Query: 211 SCSRNGASTSTPRKAQRCSSKGVALRTPR*ASPSRLGASTPPPPP 77 S S + + PRK R S LR R +S S +S PPPPP Sbjct: 359 SYSSSPSPRRIPRKISRSRSPKRPLRGKRSSSNSSSSSSPPPPPP 403 >At1g16610.1 68414.m01989 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 414 Score = 33.1 bits (72), Expect = 0.15 Identities = 17/44 (38%), Positives = 25/44 (56%) Frame = -3 Query: 211 SCSRNGASTSTPRKAQRCSSKGVALRTPR*ASPSRLGASTPPPP 80 S SR+ +S+S+P ++ S+ R A P+R G S PPPP Sbjct: 39 SRSRSLSSSSSPSRSVSSGSRSPPRRGKSPAGPARRGRSPPPPP 82 Score = 31.1 bits (67), Expect = 0.60 Identities = 18/45 (40%), Positives = 22/45 (48%) Frame = -3 Query: 211 SCSRNGASTSTPRKAQRCSSKGVALRTPR*ASPSRLGASTPPPPP 77 S S + + PRK R S LR R +S S +S PPPPP Sbjct: 366 SYSSSPSPRRIPRKISRSRSPKRPLRGKRSSSNSSSSSSPPPPPP 410 >At2g37100.1 68415.m04552 protamine P1 family protein contains Pfam PF00260: Protamine P1 Length = 297 Score = 31.5 bits (68), Expect = 0.46 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -3 Query: 121 ASPSRLGASTPPPPPFAQSRCSTSPYRGPRRSN 23 AS + +TPP F +RC ++PYR P +N Sbjct: 173 ASSCKSFTATPPRNAFLLTRCRSAPYRSPSSAN 205 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 31.1 bits (67), Expect = 0.60 Identities = 22/71 (30%), Positives = 29/71 (40%), Gaps = 1/71 (1%) Frame = -3 Query: 286 TAIYYSGRKKACFIDDFRPQLPPWDSCSRNGASTSTPR-KAQRCSSKGVALRTPR*ASPS 110 TA SG+ + ++ P+ P + S AS P A + S R P A P Sbjct: 336 TASVLSGKSFSGKVEPLPPEPPKFLKVSSKKASAPPPPVPAPQMPSSAGPPRPPPPAPPP 395 Query: 109 RLGASTPPPPP 77 G PPPPP Sbjct: 396 GSGGPKPPPPP 406 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 31.1 bits (67), Expect = 0.60 Identities = 22/71 (30%), Positives = 29/71 (40%), Gaps = 1/71 (1%) Frame = -3 Query: 286 TAIYYSGRKKACFIDDFRPQLPPWDSCSRNGASTSTPR-KAQRCSSKGVALRTPR*ASPS 110 TA SG+ + ++ P+ P + S AS P A + S R P A P Sbjct: 336 TASVLSGKSFSGKVEPLPPEPPKFLKVSSKKASAPPPPVPAPQMPSSAGPPRPPPPAPPP 395 Query: 109 RLGASTPPPPP 77 G PPPPP Sbjct: 396 GSGGPKPPPPP 406 >At1g08170.1 68414.m00902 histone H2B family protein similar to histone H2B from Chlamydomonas reinhardtii [SP|P54347, SP|P54346, SP|P50565], Volvox carteri [SP|P16867, SP|P16868]; contains Pfam profile PF00125 Core histone H2A/H2B/H3/H4 Length = 243 Score = 30.3 bits (65), Expect = 1.1 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = -2 Query: 131 TTLSIPLPTRRVNTPAPAVRPITMFDQPIPWAPK 30 TT+ IP+ R ++P P P+ + D+P P P+ Sbjct: 79 TTVKIPVDDRDESSPQPPETPVEVRDEPSPQPPE 112 >At4g27520.1 68417.m03952 plastocyanin-like domain-containing protein similar to PIR|JC7196 phytocyanin-related protein Pn14 {Ipomoea nil}; contains Pfam profile PF02298: Plastocyanin-like domain Length = 349 Score = 29.9 bits (64), Expect = 1.4 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 2/60 (3%) Frame = -2 Query: 203 PKWRIDINPTKST--AVLFKRGRPPNTTLSIPLPTRRVNTPAPAVRPITMFDQPIPWAPK 30 PK ++P S ++ K G P + T S P P + + +P+ P+T P P APK Sbjct: 187 PKSSSAVSPATSPPGSMAPKSGSPVSPTTSPPAPPKSTSPVSPSSAPMT--SPPAPMAPK 244 >At2g40116.1 68415.m04933 phosphoinositide-specific phospholipase C family protein contains Pfam profile: PF00388 phosphatidylinositol-specific phospholipase C Length = 613 Score = 29.9 bits (64), Expect = 1.4 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = +3 Query: 78 GGGGGVDAPSREGDAQRGVRRATPFEEHRCAF 173 GGGGG D S +GD GV A E C+F Sbjct: 51 GGGGGTDGDSSDGDGSTGVMGA----EQLCSF 78 >At4g17940.1 68417.m02672 expressed protein Length = 274 Score = 29.5 bits (63), Expect = 1.8 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 69 WANGGGGGVDAPSREGDAQRGVRRATP 149 + NGGGGG + S+ GD R + R+ P Sbjct: 136 YGNGGGGGYEDKSKIGDYYREMLRSNP 162 >At3g24540.1 68416.m03082 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 509 Score = 29.5 bits (63), Expect = 1.8 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = -3 Query: 136 RTPR*ASPSRLGASTPPPPPFAQSRCSTSPYRGP 35 R+P ++P RLG PPPP + T+P P Sbjct: 76 RSPSTSTPPRLGNRNPPPPASPSGQEPTTPTMTP 109 Score = 27.9 bits (59), Expect = 5.6 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = -3 Query: 97 STPPPPPFAQSRCSTSPYRGPRRSNI*ASPR 5 S PPPPP A S SP PR + PR Sbjct: 55 SEPPPPPKAPVNVSLSPPPPPRSPSTSTPPR 85 >At2g33690.1 68415.m04129 late embryogenesis abundant protein, putative / LEA protein, putative similar to responsive to water deficit, novel late embryogenesis abundant-like protein PvLEA-18 (GI:2347086) [Phaseolus vulgaris] Length = 71 Score = 29.5 bits (63), Expect = 1.8 Identities = 16/35 (45%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = +3 Query: 21 IFDLRGPRYGLVEHRDWANGGGGGV-DAPSREGDA 122 I D + YG H+D G GGG DAP+ GDA Sbjct: 23 IEDYKKNAYGTSGHQDVKPGHGGGTTDAPTPSGDA 57 >At5g55020.1 68418.m06853 myb family transcription factor (MYB120) contains Pfam profile: PF00249 myb-like DNA-binding domain Length = 523 Score = 29.1 bits (62), Expect = 2.4 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = -3 Query: 118 SPSRLGASTPPPPPFAQSRCS 56 +PS+L +STPPPPP + CS Sbjct: 226 TPSQL-SSTPPPPPLSSPLCS 245 >At5g07820.1 68418.m00896 expressed protein Length = 561 Score = 28.3 bits (60), Expect = 4.2 Identities = 18/44 (40%), Positives = 21/44 (47%), Gaps = 2/44 (4%) Frame = -3 Query: 193 ASTSTPRKAQRCSSKGVALRTPR*A-SPSRLGAS-TPPPPPFAQ 68 + TS P K Q S+ V P P R+G TPPPPP Q Sbjct: 379 SKTSLPEKKQSGSANLVTNPKPESKIRPKRIGLKVTPPPPPTKQ 422 >At4g31580.1 68417.m04485 splicing factor RSZp22 (RSZP22) / 9G8-like SR protein (SRZ22) identical to RSZp22 protein [Arabidopsis thaliana] gi|2582645|emb|CAA05352, 9G8-like SR protein [Arabidopsis thaliana] GI:3435094; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) and PF00098: Zinc knuckle; identical to cDNA 9G8-like SR protein (SRZ22) GI:3435093 Length = 200 Score = 28.3 bits (60), Expect = 4.2 Identities = 17/52 (32%), Positives = 24/52 (46%) Frame = -3 Query: 202 RNGASTSTPRKAQRCSSKGVALRTPR*ASPSRLGASTPPPPPFAQSRCSTSP 47 R+ + + TP + +R S G +PR SP +P PPP S SP Sbjct: 124 RSKSRSRTPPRYRRSPSYGRRSYSPRARSPPPPRRRSPSPPPARGRSYSRSP 175 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 28.3 bits (60), Expect = 4.2 Identities = 14/37 (37%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = -2 Query: 140 PPNTTLSIPLPTRRVNTPAPAVRP-ITMFDQPIPWAP 33 PP T S+P PT V+ P P P + P+P P Sbjct: 137 PPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVPTDP 173 >At2g35640.1 68415.m04371 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 340 Score = 28.3 bits (60), Expect = 4.2 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = -3 Query: 115 PSRLGASTPPPPPFAQSRCSTSPYRGPRRSNI*ASP 8 P+ + S PPPPP + S SP + P S+ A P Sbjct: 188 PTTIVLSLPPPPPQSLSLSLPSPPQPPPSSSFHAEP 223 >At1g62870.1 68414.m07099 expressed protein Length = 796 Score = 28.3 bits (60), Expect = 4.2 Identities = 17/55 (30%), Positives = 23/55 (41%) Frame = -1 Query: 321 LRRPIWRSSPMTPPSTTRVGRRLASSTTSDRSYHHGTVVPEMAHRHQPHEKHSGA 157 L +PI SP PP + R+ SS ++HH H PH H G+ Sbjct: 112 LPKPISTISPSPPPPPSSSHRKRNSSAVEALNHHH----------HHPHHHHQGS 156 >At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At4g04980, At5g61090 [Arabidopsis thaliana]; identical to cDNA CHUP1 for actin binding protein GI:28071264 Length = 1004 Score = 25.4 bits (53), Expect(2) = 4.6 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = -3 Query: 178 PRKAQRCSSKGVALRTPR*ASPSRLGASTPPPPP 77 PR R + G + P P G PPPPP Sbjct: 652 PRPPPRSAGGGKSTNLPSARPPLPGGGPPPPPPP 685 Score = 21.0 bits (42), Expect(2) = 4.6 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = -3 Query: 103 GASTPPPPPFAQSR 62 G PPPPP A R Sbjct: 697 GPPPPPPPPGALGR 710 >At5g65630.1 68418.m08256 DNA-binding bromodomain-containing protein similar to 5.9 kb fsh membrane protein [Drosophila melanogaster] GI:157455; contains Pfam profile PF00439: Bromodomain Length = 590 Score = 27.9 bits (59), Expect = 5.6 Identities = 20/69 (28%), Positives = 28/69 (40%), Gaps = 4/69 (5%) Frame = -3 Query: 271 SGRKKACFIDDFRP----QLPPWDSCSRNGASTSTPRKAQRCSSKGVALRTPR*ASPSRL 104 S R + F DF+ Q PP + R G + K P+ PSR+ Sbjct: 285 SSRPEPDFKPDFKQRQWNQNPPMVANPRKGTEQISIAKKLDSVKPPQPTLPPQLVEPSRV 344 Query: 103 GASTPPPPP 77 + +PPPPP Sbjct: 345 QSPSPPPPP 353 >At3g29800.1 68416.m03792 AAA-type ATPase family contains Pfam profile: ATPase family PF00004 Length = 440 Score = 27.9 bits (59), Expect = 5.6 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = -3 Query: 280 IYYSGRKKACFIDDFRPQLPPWDSCSRNGASTSTPRKAQ 164 + YS K+ IDD PQ+P + +N S PRK+Q Sbjct: 376 VRYSSSKENDHIDDDLPQIP--EETRKNSNLDSKPRKSQ 412 >At2g23120.1 68415.m02758 expressed protein Length = 83 Score = 27.9 bits (59), Expect = 5.6 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = +3 Query: 27 DLRGPRYGLVEHRDWANG-GGGGVDAPSREGDA 122 D + YG H++ G GGG DAP+ GDA Sbjct: 40 DYKLKAYGAEGHQEPTPGLGGGSTDAPTPSGDA 72 >At2g11090.1 68415.m01187 expressed protein Length = 151 Score = 27.9 bits (59), Expect = 5.6 Identities = 20/58 (34%), Positives = 25/58 (43%), Gaps = 1/58 (1%) Frame = -1 Query: 354 PREAISASAPGLRRPIWRSSPM-TPPSTTRVGRRLASSTTSDRSYHHGTVVPEMAHRH 184 P I + R P SSP T P T GR+ SS + D S H VP + R+ Sbjct: 90 PSTTIPITRLHTRLPASESSPFCTQPDTRAEGRKEDSSLSLDHSLDHLGRVPFLIRRN 147 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 27.5 bits (58), Expect = 7.4 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = -3 Query: 97 STPPPPPFAQSRCSTSPYRGPRRSNI*ASP 8 + PPPPP Q+R ++P P + SP Sbjct: 774 TAPPPPPLGQTRAPSAPPPPPPKLGTKLSP 803 >At2g17450.1 68415.m02014 zinc finger (C3HC4-type RING finger) family protein contains Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 185 Score = 27.5 bits (58), Expect = 7.4 Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = -1 Query: 261 RRLASSTTSDRSYHHGTV-VPEMAHRHQPHEKHS 163 RR+ + DR H T + + AHRHQ H+ S Sbjct: 144 RRILTPVRCDRCGHASTAEMKDQAHRHQHHQHSS 177 >At1g42740.1 68414.m04939 hypothetical protein Length = 359 Score = 27.5 bits (58), Expect = 7.4 Identities = 17/55 (30%), Positives = 25/55 (45%) Frame = -3 Query: 241 DFRPQLPPWDSCSRNGASTSTPRKAQRCSSKGVALRTPR*ASPSRLGASTPPPPP 77 D PQ +S ++PR+ + S+ + L P P RL S+PPP P Sbjct: 222 DRHPQQTALESFITAVIDAASPRQTAKSSTAPLLLNPP----PKRLRYSSPPPTP 272 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 27.5 bits (58), Expect = 7.4 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = -3 Query: 178 PRKAQRCSSKGVALRTPR*ASPSRLGASTPPPPP 77 P KA ++ P S +RLGA PPPPP Sbjct: 687 PPKANISNAPKPPAPPPLPPSSTRLGAPPPPPPP 720 Score = 25.0 bits (52), Expect(2) = 7.6 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = -3 Query: 91 PPPPPFAQSRCSTSPYRGP 35 PPPPP S S SP + P Sbjct: 508 PPPPPLFMSTTSFSPSQPP 526 Score = 20.6 bits (41), Expect(2) = 7.6 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = -3 Query: 130 PR*ASPSRLGASTPPPPP 77 P S + S PPPPP Sbjct: 491 PLFTSTTSFSPSQPPPPP 508 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 23.4 bits (48), Expect(2) = 8.3 Identities = 20/71 (28%), Positives = 25/71 (35%), Gaps = 4/71 (5%) Frame = -3 Query: 277 YYSGRKKACF----IDDFRPQLPPWDSCSRNGASTSTPRKAQRCSSKGVALRTPR*ASPS 110 ++SG AC DD R LP S C+S G + +P P Sbjct: 326 FFSGEPPACLRLQEFDDRRNCLPSRPMQRSLAECKSFSSYPIDCASFGCSPPSPPPPPPP 385 Query: 109 RLGASTPPPPP 77 PPPPP Sbjct: 386 PPPPPPPPPPP 396 Score = 22.2 bits (45), Expect(2) = 8.3 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = -3 Query: 91 PPPPPFAQSRCSTSPYRGP 35 PPPPP+ + PY P Sbjct: 427 PPPPPYVYPPPPSPPYVYP 445 >At5g32161.1 68418.m03792 hypothetical protein Length = 193 Score = 27.1 bits (57), Expect = 9.8 Identities = 17/50 (34%), Positives = 20/50 (40%) Frame = -2 Query: 185 INPTKSTAVLFKRGRPPNTTLSIPLPTRRVNTPAPAVRPITMFDQPIPWA 36 I P ST +TTL PL R TP RP T+ PW+ Sbjct: 62 ILPVHSTTRSSNLSSGHSTTLLDPLVEYRFATPPDHTRPFTLPRYSTPWS 111 >At5g07770.1 68418.m00889 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 722 Score = 27.1 bits (57), Expect = 9.8 Identities = 24/77 (31%), Positives = 31/77 (40%), Gaps = 7/77 (9%) Frame = -3 Query: 235 RPQLPPWDSCSRNGASTSTPRKAQRCSS----KGVALRTPR*ASPSRLGASTPPPPP--- 77 RP P +C R A PR C + V + +P PS G + PPPPP Sbjct: 601 RPPSRPRYACCRIPAVNPPPRLV--CGPYPLPRLVRVGSPSPPPPSMSGGAPPPPPPPPM 658 Query: 76 FAQSRCSTSPYRGPRRS 26 SR + P+ RS Sbjct: 659 LVASRTAPPPHLSHVRS 675 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 27.1 bits (57), Expect = 9.8 Identities = 14/49 (28%), Positives = 21/49 (42%) Frame = -3 Query: 223 PPWDSCSRNGASTSTPRKAQRCSSKGVALRTPR*ASPSRLGASTPPPPP 77 PP +S N ++P K +R + + SP +PPPPP Sbjct: 603 PPLESPVPNDPYDASPIKKRRPQPPSPSTEETKTTSPQSPPVHSPPPPP 651 >At2g34670.1 68415.m04259 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 561 Score = 27.1 bits (57), Expect = 9.8 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = -3 Query: 157 SSKGVALRTPR*ASPSRLGASTPPPPPFA 71 +S G++L P + P L S PPPPPF+ Sbjct: 66 TSYGLSLPLPP-SPPPTLPPSPPPPPPFS 93 >At1g70640.1 68414.m08143 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein contains Pfam profile PF00564: PB1 domain Length = 174 Score = 27.1 bits (57), Expect = 9.8 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = -2 Query: 200 KWRIDINPTKSTAVLFKRGRPPNTTLSIPLPTRRVNTPAPA 78 K + ++P KST PP+TT S +R + P+P+ Sbjct: 100 KIHVFLSPLKSTRTTANSSPPPSTTSSSSSKSRSRSPPSPS 140 >At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibitor family protein low similarity to extensin [Volvox carteri] GI:21992 Length = 312 Score = 27.1 bits (57), Expect = 9.8 Identities = 20/60 (33%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Frame = -3 Query: 211 SCSRNGASTSTPRKAQRCSSKGVALRTPR*ASPSRLGASTPPPPPFAQSRCST-SPYRGP 35 S S + S S + SS + +P P L S+PPPPP + S S+ SP P Sbjct: 28 SPSSSSPSLSPSPPSSSPSSAPPSSLSPSSPPPLSLSPSSPPPPPPSSSPLSSLSPSLSP 87 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 27.1 bits (57), Expect = 9.8 Identities = 16/44 (36%), Positives = 21/44 (47%), Gaps = 2/44 (4%) Frame = -3 Query: 151 KGVALRTPR*ASPSRLGASTPPPPPFAQSRCSTSP--YRGPRRS 26 KG A P P + GA PPPPP ++ P +GP +S Sbjct: 403 KGPAAPPPP-PPPGKKGAGPPPPPPMSKKGPPKPPGNPKGPTKS 445 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 27.1 bits (57), Expect = 9.8 Identities = 18/67 (26%), Positives = 23/67 (34%) Frame = -3 Query: 235 RPQLPPWDSCSRNGASTSTPRKAQRCSSKGVALRTPR*ASPSRLGASTPPPPPFAQSRCS 56 RP PP DS + P++ ++ G TP SPS P PP Sbjct: 206 RPSTPPSDSEHPSPPPPGHPKRREQPPPPGSKRPTPSPPSPSDSKRPVHPSPPSPPEETL 265 Query: 55 TSPYRGP 35 P P Sbjct: 266 PPPKPSP 272 >At2g25050.1 68415.m02996 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 1111 Score = 23.8 bits (49), Expect(2) = 9.9 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -3 Query: 91 PPPPPFAQSRCSTSP 47 PPPPP + R + SP Sbjct: 575 PPPPPISSLRSTPSP 589 Score = 21.4 bits (43), Expect(2) = 9.9 Identities = 18/61 (29%), Positives = 21/61 (34%), Gaps = 7/61 (11%) Frame = -3 Query: 238 FRPQLPPWDSCSRNGASTSTPRKAQRCSSKGVALRTPR*AS-------PSRLGASTPPPP 80 F P L P S AS P+ S G S P R+ + PPPP Sbjct: 516 FLPTLHPLTSSQPKKASPQCPQSPTPVHSNGPPSAEAAVTSSPLPPLKPLRILSRPPPPP 575 Query: 79 P 77 P Sbjct: 576 P 576 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,130,531 Number of Sequences: 28952 Number of extensions: 322001 Number of successful extensions: 1728 Number of sequences better than 10.0: 37 Number of HSP's better than 10.0 without gapping: 1273 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1678 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1226538000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -