BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0185 (489 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 22 3.4 AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. 21 4.5 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 21 4.5 EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopre... 21 7.9 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 21.8 bits (44), Expect = 3.4 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = -1 Query: 267 SQSRGTIVPEGGFTPV 220 ++ T+VPEG TP+ Sbjct: 162 AREEATVVPEGSRTPI 177 >AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. Length = 209 Score = 21.4 bits (43), Expect = 4.5 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = -1 Query: 42 DDVRSPTCPLPL 7 DDVRSP P PL Sbjct: 87 DDVRSPGTPGPL 98 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 21.4 bits (43), Expect = 4.5 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = -1 Query: 42 DDVRSPTCPLPL 7 DDVRSP P PL Sbjct: 243 DDVRSPGTPGPL 254 >EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopressin receptor protein. Length = 403 Score = 20.6 bits (41), Expect = 7.9 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +2 Query: 77 ASLRGPTTSSD*TQRKNPTMAAREKINVIVQSQG*SLMY 193 +SLR P +S K + +R KIN + Q+ +MY Sbjct: 236 SSLR-PRSSQKSAPGKRTPLISRAKINTVKQTIAVIVMY 273 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 109,399 Number of Sequences: 336 Number of extensions: 2154 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11420693 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -