BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0183 (523 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q17DE2 Cluster: Vacuolar protein sorting 18; n=2; Culic... 33 4.0 >UniRef50_Q17DE2 Cluster: Vacuolar protein sorting 18; n=2; Culicidae|Rep: Vacuolar protein sorting 18 - Aedes aegypti (Yellowfever mosquito) Length = 978 Score = 33.1 bits (72), Expect = 4.0 Identities = 22/83 (26%), Positives = 41/83 (49%), Gaps = 1/83 (1%) Frame = +2 Query: 50 LL*DFHRIVLYSYNYLLFILTNICILFARLFVELFSKLC*SCLSI-DVVSQPFTT*LILK 226 +L DFH I+LY + L N +++ FVE + KLC + V+ ++ +I + Sbjct: 353 VLTDFHAILLYVDHVTAISLLNYQVVYEEYFVEQYGKLCNVVRDVRSNVTYVYSNKMIFR 412 Query: 227 YSKIGHPSYPTF*LI*QKSKFQI 295 Y KI + + L ++ K+ + Sbjct: 413 Y-KINNEQRNAWRLYAERQKYDL 434 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 442,474,371 Number of Sequences: 1657284 Number of extensions: 7397782 Number of successful extensions: 15644 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 15225 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15633 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 32619212418 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -