BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0179 (519 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0728 + 5553506-5553954,5554749-5554836,5556945-5557199,555... 29 3.0 01_06_0782 + 31969677-31969767,31969863-31969960,31970059-319702... 28 5.2 >07_01_0728 + 5553506-5553954,5554749-5554836,5556945-5557199, 5557816-5557988,5558134-5558242 Length = 357 Score = 28.7 bits (61), Expect = 3.0 Identities = 13/42 (30%), Positives = 30/42 (71%) Frame = +2 Query: 185 TTLTHNNMGVGINIFLFVDLNSVRNLFVVFPVKEKVHSFRPI 310 T +TH++ VG+ + L +L+ V+++ V+F + ++V+ +RP+ Sbjct: 231 TGITHSHASVGVVVRLRKELSLVKDVPVLFAI-DQVNVYRPM 271 >01_06_0782 + 31969677-31969767,31969863-31969960,31970059-31970235, 31970367-31970467,31970626-31970701,31970827-31970886, 31970979-31971215,31971612-31971686,31971981-31972039, 31972110-31972201,31972463-31972623,31972964-31973176 Length = 479 Score = 27.9 bits (59), Expect = 5.2 Identities = 10/20 (50%), Positives = 16/20 (80%) Frame = +2 Query: 212 VGINIFLFVDLNSVRNLFVV 271 VG++ F ++NS+RNLF+V Sbjct: 358 VGLSFLQFTNMNSMRNLFIV 377 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,810,150 Number of Sequences: 37544 Number of extensions: 201364 Number of successful extensions: 254 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 249 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 254 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1130733700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -