BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0178 (525 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_04_0369 - 16885918-16886080,16886235-16886671,16886767-168870... 29 2.3 02_05_0601 - 30278455-30278572,30280211-30280676,30280748-302809... 27 7.0 >11_04_0369 - 16885918-16886080,16886235-16886671,16886767-16887028, 16887050-16887353,16887771-16888166,16888531-16888579, 16889303-16889737 Length = 681 Score = 29.1 bits (62), Expect = 2.3 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = +2 Query: 221 TKHCSWLSEPLYQNSTK*IDMKFCKYDKSKYTTMIPSTKTL 343 +K+ SWL EP + N T I FCK ++ +PS + L Sbjct: 487 SKYPSWLGEPSFSNLTT-IKFLFCKSERLPTLGELPSLQFL 526 >02_05_0601 - 30278455-30278572,30280211-30280676,30280748-30280951, 30281065-30281220,30281336-30281738 Length = 448 Score = 27.5 bits (58), Expect = 7.0 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = +2 Query: 287 FCKYDKSKYTTMIPSTKTLVILIITSNIITLRLV 388 F + D KYT+ + +V ++IT+ I T++L+ Sbjct: 183 FKRVDSLKYTSALSVALAVVFVVITAGITTIKLM 216 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,009,604 Number of Sequences: 37544 Number of extensions: 185739 Number of successful extensions: 235 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 230 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 235 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1154538620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -