BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0178 (525 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g15250.1 68417.m02337 zinc finger (B-box type) family protein 28 3.3 At5g06350.1 68418.m00711 expressed protein 27 7.7 At3g30390.1 68416.m03836 amino acid transporter family protein l... 27 7.7 >At4g15250.1 68417.m02337 zinc finger (B-box type) family protein Length = 330 Score = 28.3 bits (60), Expect = 3.3 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = -3 Query: 241 QPTAVFCISDKINLLMGI*GVSSFCKGV 158 QPTAV C+++ ++L G +S C G+ Sbjct: 54 QPTAVHCMNENVSLCQGCQWTASNCTGL 81 >At5g06350.1 68418.m00711 expressed protein Length = 890 Score = 27.1 bits (57), Expect = 7.7 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = -1 Query: 252 RGSLNQLQCFVSVIKLIYLWGSEVSVHFVKGLFCPK 145 R SLN +QC +SVI L++ ++V V + F P+ Sbjct: 815 RNSLNMIQCIISVILLMH---NDVKVRKIISSFKPE 847 >At3g30390.1 68416.m03836 amino acid transporter family protein low similarity to neuronal glutamine transporter [Rattus norvegicus] GI:6978016; belongs to INTERPRO:IPR002422 amino acid/polyamine transporter, family II Length = 460 Score = 27.1 bits (57), Expect = 7.7 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = +2 Query: 287 FCKYDKSKYTTMIPSTKTLVILIITSNIITLRLVS 391 F + D K+T+ + +V LIIT+ I ++L+S Sbjct: 189 FKRIDSLKFTSALSVALAVVFLIITAGISIMKLIS 223 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,743,031 Number of Sequences: 28952 Number of extensions: 175027 Number of successful extensions: 322 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 320 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 322 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 967280384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -