BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0176 (527 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 23 1.7 AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory recept... 23 2.2 AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory recept... 23 2.2 AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix... 22 3.8 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 23.0 bits (47), Expect = 1.7 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -2 Query: 94 LFSFHFQLELILK*NFEITTGTSM*RKPF 8 LF HF +++ N I GT + +PF Sbjct: 668 LFHCHFLFHIVIGMNLIIHVGTQLIYRPF 696 >AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory receptor candidate 13 protein. Length = 390 Score = 22.6 bits (46), Expect = 2.2 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 436 NIFVCNVLSRFEMMHR 389 NI+VC +S FE R Sbjct: 196 NIYVCQTVSNFEYFQR 211 >AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory receptor candidate 12 protein. Length = 316 Score = 22.6 bits (46), Expect = 2.2 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 436 NIFVCNVLSRFEMMHR 389 NI+VC +S FE R Sbjct: 122 NIYVCQTVSNFEYFQR 137 >AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix transcription factor protein. Length = 249 Score = 21.8 bits (44), Expect = 3.8 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = -3 Query: 180 IFPWQDSNPRPPCVVTMSLTTTPDGLSSNYSVS 82 + P Q ++P P V T + +SNYS S Sbjct: 187 VLPTQGASPLPLLVPIPQRTASTASSASNYSPS 219 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 113,199 Number of Sequences: 336 Number of extensions: 2204 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12782794 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -