BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0176 (527 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59672| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.6 SB_23414| Best HMM Match : Tetraspannin (HMM E-Value=3.8e-08) 27 9.6 >SB_59672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 27.1 bits (57), Expect = 9.6 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = +3 Query: 390 RCIISNLDSTLQTKIFALPDAIYSHGLHHC*CTETIRACHT 512 RC + L TL T+ + + SH HH T T+R +T Sbjct: 7 RCYHTTLQITLTTRHYTITLTTRSHSRHHPTSTFTVRPHNT 47 >SB_23414| Best HMM Match : Tetraspannin (HMM E-Value=3.8e-08) Length = 357 Score = 27.1 bits (57), Expect = 9.6 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +1 Query: 394 ASFQTLTVHCKRKYSLYQTRFTVTDFII 477 ASF T+ C RK S+ Q RF + F+I Sbjct: 109 ASFILCTLGCSRKPSIKQLRFYRSSFVI 136 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,072,646 Number of Sequences: 59808 Number of extensions: 249371 Number of successful extensions: 644 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 593 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 643 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1197191618 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -