BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0176 (527 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81038-6|CAB02756.1| 233|Caenorhabditis elegans Hypothetical pr... 27 8.3 DQ340627-1|ABC65815.1| 233|Caenorhabditis elegans chondroitin p... 27 8.3 >Z81038-6|CAB02756.1| 233|Caenorhabditis elegans Hypothetical protein C25A1.8 protein. Length = 233 Score = 27.1 bits (57), Expect = 8.3 Identities = 17/52 (32%), Positives = 23/52 (44%), Gaps = 5/52 (9%) Frame = +3 Query: 162 NPAKGRYLYDKYKCIFQGYGCILNICMCIIKS-----YIYFRYLVPVTQVLY 302 NP K +L YK +F G+ + N C KS + Y P T +LY Sbjct: 169 NPTKINWLIKPYKPLFNGWSSLAN-CAASYKSPSSLESASYTYFYPCTYMLY 219 >DQ340627-1|ABC65815.1| 233|Caenorhabditis elegans chondroitin proteoglycan-5 protein. Length = 233 Score = 27.1 bits (57), Expect = 8.3 Identities = 17/52 (32%), Positives = 23/52 (44%), Gaps = 5/52 (9%) Frame = +3 Query: 162 NPAKGRYLYDKYKCIFQGYGCILNICMCIIKS-----YIYFRYLVPVTQVLY 302 NP K +L YK +F G+ + N C KS + Y P T +LY Sbjct: 169 NPTKINWLIKPYKPLFNGWSSLAN-CAASYKSPSSLESASYTYFYPCTYMLY 219 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,504,141 Number of Sequences: 27780 Number of extensions: 191505 Number of successful extensions: 430 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 427 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 430 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1038911524 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -