BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0175 (520 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q0UIJ9 Cluster: Putative uncharacterized protein; n=1; ... 33 3.0 UniRef50_Q18ER3 Cluster: DNA polymerase II large subunit (EC 2.7... 33 3.0 UniRef50_A2FAI5 Cluster: Ankyrin repeat protein, putative; n=1; ... 33 5.2 UniRef50_Q8IB74 Cluster: Putative uncharacterized protein PF08_0... 32 9.0 UniRef50_O97264 Cluster: Putative uncharacterized protein MAL3P5... 32 9.0 >UniRef50_Q0UIJ9 Cluster: Putative uncharacterized protein; n=1; Phaeosphaeria nodorum|Rep: Putative uncharacterized protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 521 Score = 33.5 bits (73), Expect = 3.0 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = -2 Query: 510 NTLRKVQKSYSTTLRWCKKHGQPKYP 433 NTLR + S L W KHG+P+YP Sbjct: 211 NTLRVLHASAEKELAWIDKHGKPRYP 236 >UniRef50_Q18ER3 Cluster: DNA polymerase II large subunit (EC 2.7.7.7) (Pol II) [Contains: Hwa polC 1 intein (Hwa pol II 1 intein); Hwa polC 2 intein (Hwa pol II 2 intein)]; n=3; Halobacteriaceae|Rep: DNA polymerase II large subunit (EC 2.7.7.7) (Pol II) [Contains: Hwa polC 1 intein (Hwa pol II 1 intein); Hwa polC 2 intein (Hwa pol II 2 intein)] - Haloquadratum walsbyi (strain DSM 16790) Length = 2289 Score = 33.5 bits (73), Expect = 3.0 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -2 Query: 486 SYSTTLRWCKKHGQPKYPPYTYIF*D 409 ++ +RW KKH P +P YTY++ D Sbjct: 495 TFENAMRWAKKHDIPLHPAYTYLWHD 520 >UniRef50_A2FAI5 Cluster: Ankyrin repeat protein, putative; n=1; Trichomonas vaginalis G3|Rep: Ankyrin repeat protein, putative - Trichomonas vaginalis G3 Length = 262 Score = 32.7 bits (71), Expect = 5.2 Identities = 12/35 (34%), Positives = 25/35 (71%) Frame = -3 Query: 440 NIHLIHTYFKMHIYIYIVQDDITDLKYM*FYSLEN 336 +I+ I TY ++Y+ ++Q+DI+++ Y F+ +EN Sbjct: 49 DIYPIITYNNFYLYLILLQEDISNIIYAPFFGIEN 83 >UniRef50_Q8IB74 Cluster: Putative uncharacterized protein PF08_0030; n=1; Plasmodium falciparum 3D7|Rep: Putative uncharacterized protein PF08_0030 - Plasmodium falciparum (isolate 3D7) Length = 807 Score = 31.9 bits (69), Expect = 9.0 Identities = 13/36 (36%), Positives = 23/36 (63%) Frame = +1 Query: 40 YIINDKKKLNISGKNEKKK*SQNIILSKEKQKKTKL 147 Y++N+ K LNI K +K + + + + +K K KK +L Sbjct: 723 YVVNNNKNLNIPSKKDKPQINNHSVRNKLKSKKDEL 758 >UniRef50_O97264 Cluster: Putative uncharacterized protein MAL3P5.11; n=1; Plasmodium falciparum 3D7|Rep: Putative uncharacterized protein MAL3P5.11 - Plasmodium falciparum (isolate 3D7) Length = 611 Score = 31.9 bits (69), Expect = 9.0 Identities = 14/35 (40%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = -1 Query: 118 KVLYSEIIFFFHFFQKYLIFFCRLLYK-FKANYAL 17 K + + FF FF KYL+F C ++K FK++ +L Sbjct: 535 KSIITLYFLFFQFFYKYLVFHCEDIFKNFKSHISL 569 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 417,474,685 Number of Sequences: 1657284 Number of extensions: 7119458 Number of successful extensions: 19019 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 16879 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18775 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 32201017387 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -