BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0173 (519 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT007426-1|AAP36094.1| 427|Homo sapiens potassium intermediate/... 31 1.8 BC015337-1|AAH15337.1| 427|Homo sapiens potassium intermediate/... 31 1.8 AF305735-1|AAG26917.1| 427|Homo sapiens intermediate-conductanc... 31 1.8 AF033021-1|AAC36804.1| 427|Homo sapiens intermediate conductanc... 31 1.8 AF022797-1|AAC51913.1| 427|Homo sapiens intermediate conductanc... 31 1.8 AF022150-1|AAC23541.1| 427|Homo sapiens hIK1 protein. 31 1.8 AF000972-1|AAB82739.1| 427|Homo sapiens calcium-activated potas... 31 1.8 AF395661-1|AAK81862.1| 427|Homo sapiens potassium intermediate/... 31 3.2 Y13667-1|CAA74018.1| 667|Homo sapiens putative transcription fa... 29 9.8 BC110315-1|AAI10316.1| 336|Homo sapiens SYTL2 protein protein. 29 9.8 BC053626-1|AAH53626.1| 667|Homo sapiens midline 1 (Opitz/BBB sy... 29 9.8 BC015540-1|AAH15540.1| 376|Homo sapiens synaptotagmin-like 2 pr... 29 9.8 AY386362-1|AAR25619.1| 1780|Homo sapiens breast cancer-associate... 29 9.8 AL834422-1|CAD39083.1| 238|Homo sapiens hypothetical protein pr... 29 9.8 AK131365-1|BAD18516.1| 579|Homo sapiens protein. 29 9.8 AK124754-1|BAC85937.1| 893|Homo sapiens protein ( Homo sapiens ... 29 9.8 AK074737-1|BAC11170.1| 376|Homo sapiens protein ( Homo sapiens ... 29 9.8 AK024872-1|BAB15030.1| 376|Homo sapiens protein ( Homo sapiens ... 29 9.8 AF269101-1|AAG33130.1| 667|Homo sapiens midline 1 protein. 29 9.8 AF230977-1|AAG50192.1| 552|Homo sapiens tripartite motif protei... 29 9.8 AF230976-1|AAG50191.1| 667|Homo sapiens tripartite motif protei... 29 9.8 AF041210-1|AAC33002.1| 630|Homo sapiens midline 1 fetal kidney ... 29 9.8 AF041209-1|AAC33001.1| 667|Homo sapiens midline 1 fetal kidney ... 29 9.8 AF041208-1|AAC33000.1| 667|Homo sapiens midline 1 fetal kidney ... 29 9.8 AF035360-1|AAB99951.1| 667|Homo sapiens ring finger protein pro... 29 9.8 >BT007426-1|AAP36094.1| 427|Homo sapiens potassium intermediate/small conductance calcium-activated channel, subfamily N protein. Length = 427 Score = 31.5 bits (68), Expect = 1.8 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = +3 Query: 186 MLLFGTCIYALYLENVVSEIQASSIILRCMMATRH 290 ML FG C +ALYL V I S+ +L C++ H Sbjct: 46 MLWFGGCSWALYLFLVKCTISISTFLLLCLIVAFH 80 >BC015337-1|AAH15337.1| 427|Homo sapiens potassium intermediate/small conductance calcium-activated channel, subfamily N protein. Length = 427 Score = 31.5 bits (68), Expect = 1.8 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = +3 Query: 186 MLLFGTCIYALYLENVVSEIQASSIILRCMMATRH 290 ML FG C +ALYL V I S+ +L C++ H Sbjct: 46 MLWFGGCSWALYLFLVKCTISISTFLLLCLIVAFH 80 >AF305735-1|AAG26917.1| 427|Homo sapiens intermediate-conductance calcium-activated potassium channel 1 protein. Length = 427 Score = 31.5 bits (68), Expect = 1.8 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = +3 Query: 186 MLLFGTCIYALYLENVVSEIQASSIILRCMMATRH 290 ML FG C +ALYL V I S+ +L C++ H Sbjct: 46 MLWFGGCSWALYLFLVKCTISISTFLLLCLIVAFH 80 >AF033021-1|AAC36804.1| 427|Homo sapiens intermediate conductance calcium-activated potassium channel protein. Length = 427 Score = 31.5 bits (68), Expect = 1.8 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = +3 Query: 186 MLLFGTCIYALYLENVVSEIQASSIILRCMMATRH 290 ML FG C +ALYL V I S+ +L C++ H Sbjct: 46 MLWFGGCSWALYLFLVKCTISISTFLLLCLIVAFH 80 >AF022797-1|AAC51913.1| 427|Homo sapiens intermediate conductance calcium-activated potassium channel protein. Length = 427 Score = 31.5 bits (68), Expect = 1.8 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = +3 Query: 186 MLLFGTCIYALYLENVVSEIQASSIILRCMMATRH 290 ML FG C +ALYL V I S+ +L C++ H Sbjct: 46 MLWFGGCSWALYLFLVKCTISISTFLLLCLIVAFH 80 >AF022150-1|AAC23541.1| 427|Homo sapiens hIK1 protein. Length = 427 Score = 31.5 bits (68), Expect = 1.8 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = +3 Query: 186 MLLFGTCIYALYLENVVSEIQASSIILRCMMATRH 290 ML FG C +ALYL V I S+ +L C++ H Sbjct: 46 MLWFGGCSWALYLFLVKCTISISTFLLLCLIVAFH 80 >AF000972-1|AAB82739.1| 427|Homo sapiens calcium-activated potassium channel protein. Length = 427 Score = 31.5 bits (68), Expect = 1.8 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = +3 Query: 186 MLLFGTCIYALYLENVVSEIQASSIILRCMMATRH 290 ML FG C +ALYL V I S+ +L C++ H Sbjct: 46 MLWFGGCSWALYLFLVKCTISISTFLLLCLIVAFH 80 >AF395661-1|AAK81862.1| 427|Homo sapiens potassium intermediate/small conductance calcium-activated channel, subfamily N protein. Length = 427 Score = 30.7 bits (66), Expect = 3.2 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = +3 Query: 186 MLLFGTCIYALYLENVVSEIQASSIILRCMMATRH 290 ML FG C +ALYL V I S+ +L C++ H Sbjct: 46 MLWFGGCSWALYLFLVKCTIGISTFLLLCLIVAFH 80 >Y13667-1|CAA74018.1| 667|Homo sapiens putative transcription factor XPRF protein. Length = 667 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = -2 Query: 254 RCLNLAHDIFKIKRIYTSSEQQHSPRRSTEQ 162 R L ++HD ++R +SS++ H+P R T Q Sbjct: 495 RKLKVSHDNLTVERDESSSKKSHTPERFTSQ 525 >BC110315-1|AAI10316.1| 336|Homo sapiens SYTL2 protein protein. Length = 336 Score = 29.1 bits (62), Expect = 9.8 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +2 Query: 251 IFNYLALYDGYPPHSVMSAKAVVPSVVWFH 340 IFN+ +YDG+ P +M +A V VW H Sbjct: 244 IFNHTMVYDGFRPEDLM--EACVELTVWDH 271 >BC053626-1|AAH53626.1| 667|Homo sapiens midline 1 (Opitz/BBB syndrome) protein. Length = 667 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = -2 Query: 254 RCLNLAHDIFKIKRIYTSSEQQHSPRRSTEQ 162 R L ++HD ++R +SS++ H+P R T Q Sbjct: 495 RKLKVSHDNLTVERDESSSKKSHTPERFTSQ 525 >BC015540-1|AAH15540.1| 376|Homo sapiens synaptotagmin-like 2 protein. Length = 376 Score = 29.1 bits (62), Expect = 9.8 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +2 Query: 251 IFNYLALYDGYPPHSVMSAKAVVPSVVWFH 340 IFN+ +YDG+ P +M +A V VW H Sbjct: 284 IFNHTMVYDGFRPEDLM--EACVELTVWDH 311 >AY386362-1|AAR25619.1| 1780|Homo sapiens breast cancer-associated antigen SGA-72M protein. Length = 1780 Score = 29.1 bits (62), Expect = 9.8 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +2 Query: 251 IFNYLALYDGYPPHSVMSAKAVVPSVVWFH 340 IFN+ +YDG+ P +M +A V VW H Sbjct: 1688 IFNHTMVYDGFRPEDLM--EACVELTVWDH 1715 >AL834422-1|CAD39083.1| 238|Homo sapiens hypothetical protein protein. Length = 238 Score = 29.1 bits (62), Expect = 9.8 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +2 Query: 251 IFNYLALYDGYPPHSVMSAKAVVPSVVWFH 340 IFN+ +YDG+ P +M +A V VW H Sbjct: 146 IFNHTMVYDGFRPEDLM--EACVELTVWDH 173 >AK131365-1|BAD18516.1| 579|Homo sapiens protein. Length = 579 Score = 29.1 bits (62), Expect = 9.8 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +2 Query: 251 IFNYLALYDGYPPHSVMSAKAVVPSVVWFH 340 IFN+ +YDG+ P +M +A V VW H Sbjct: 487 IFNHTMVYDGFRPEDLM--EACVELTVWDH 514 >AK124754-1|BAC85937.1| 893|Homo sapiens protein ( Homo sapiens cDNA FLJ42764 fis, clone BRAWH3002821, moderately similar to Mus musculus synaptotagmin-like 2 (Sytl2). ). Length = 893 Score = 29.1 bits (62), Expect = 9.8 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +2 Query: 251 IFNYLALYDGYPPHSVMSAKAVVPSVVWFH 340 IFN+ +YDG+ P +M +A V VW H Sbjct: 801 IFNHTMVYDGFRPEDLM--EACVELTVWDH 828 >AK074737-1|BAC11170.1| 376|Homo sapiens protein ( Homo sapiens cDNA FLJ90256 fis, clone NT2RM4000417, highly similar to Synaptotagmin-like protein 2. ). Length = 376 Score = 29.1 bits (62), Expect = 9.8 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +2 Query: 251 IFNYLALYDGYPPHSVMSAKAVVPSVVWFH 340 IFN+ +YDG+ P +M +A V VW H Sbjct: 284 IFNHTMVYDGFRPEDLM--EACVELTVWDH 311 >AK024872-1|BAB15030.1| 376|Homo sapiens protein ( Homo sapiens cDNA: FLJ21219 fis, clone COL00541. ). Length = 376 Score = 29.1 bits (62), Expect = 9.8 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +2 Query: 251 IFNYLALYDGYPPHSVMSAKAVVPSVVWFH 340 IFN+ +YDG+ P +M +A V VW H Sbjct: 284 IFNHTMVYDGFRPEDLM--EACVELTVWDH 311 >AF269101-1|AAG33130.1| 667|Homo sapiens midline 1 protein. Length = 667 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = -2 Query: 254 RCLNLAHDIFKIKRIYTSSEQQHSPRRSTEQ 162 R L ++HD ++R +SS++ H+P R T Q Sbjct: 495 RKLKVSHDNLTVERDESSSKKSHTPERFTSQ 525 >AF230977-1|AAG50192.1| 552|Homo sapiens tripartite motif protein TRIM18 beta protein. Length = 552 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = -2 Query: 254 RCLNLAHDIFKIKRIYTSSEQQHSPRRSTEQ 162 R L ++HD ++R +SS++ H+P R T Q Sbjct: 495 RKLKVSHDNLTVERDESSSKKSHTPERFTSQ 525 >AF230976-1|AAG50191.1| 667|Homo sapiens tripartite motif protein TRIM18 alpha protein. Length = 667 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = -2 Query: 254 RCLNLAHDIFKIKRIYTSSEQQHSPRRSTEQ 162 R L ++HD ++R +SS++ H+P R T Q Sbjct: 495 RKLKVSHDNLTVERDESSSKKSHTPERFTSQ 525 >AF041210-1|AAC33002.1| 630|Homo sapiens midline 1 fetal kidney isoform 3 protein. Length = 630 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = -2 Query: 254 RCLNLAHDIFKIKRIYTSSEQQHSPRRSTEQ 162 R L ++HD ++R +SS++ H+P R T Q Sbjct: 458 RKLKVSHDNLTVERDESSSKKSHTPERFTSQ 488 >AF041209-1|AAC33001.1| 667|Homo sapiens midline 1 fetal kidney isoform 2 protein. Length = 667 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = -2 Query: 254 RCLNLAHDIFKIKRIYTSSEQQHSPRRSTEQ 162 R L ++HD ++R +SS++ H+P R T Q Sbjct: 495 RKLKVSHDNLTVERDESSSKKSHTPERFTSQ 525 >AF041208-1|AAC33000.1| 667|Homo sapiens midline 1 fetal kidney isoform 1 protein. Length = 667 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = -2 Query: 254 RCLNLAHDIFKIKRIYTSSEQQHSPRRSTEQ 162 R L ++HD ++R +SS++ H+P R T Q Sbjct: 495 RKLKVSHDNLTVERDESSSKKSHTPERFTSQ 525 >AF035360-1|AAB99951.1| 667|Homo sapiens ring finger protein protein. Length = 667 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = -2 Query: 254 RCLNLAHDIFKIKRIYTSSEQQHSPRRSTEQ 162 R L ++HD ++R +SS++ H+P R T Q Sbjct: 495 RKLKVSHDNLTVERDESSSKKSHTPERFTSQ 525 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 73,173,115 Number of Sequences: 237096 Number of extensions: 1504517 Number of successful extensions: 2248 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 2198 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2248 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4933413474 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -