BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0169 (523 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC3E7.01 |fab1|ste12, SPBC6B1.11c|1-phosphatidylinositol-3-pho... 27 1.7 SPAC959.09c |apc5|SPAP32A8.01c|anaphase-promoting complex subuni... 27 2.2 SPAPJ698.03c |prp12|sap130|U2 snRNP-associated protein Sap130 |S... 26 3.0 SPAC5D6.12 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||... 26 3.9 SPAC1783.03 |fta2|sma2|Sim4 and Mal2 associated |Schizosaccharom... 25 5.2 SPBC1289.15 ||SPBC8E4.07c|glycoprotein |Schizosaccharomyces pomb... 25 6.8 >SPBC3E7.01 |fab1|ste12, SPBC6B1.11c|1-phosphatidylinositol-3-phosphate 5-kinase Fab1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1932 Score = 27.1 bits (57), Expect = 1.7 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +1 Query: 130 HTYFCVRKRLHFL*NYYPLYFS 195 + +FC+ +R HFL + LY+S Sbjct: 889 YKFFCIDERYHFLEKQWTLYYS 910 >SPAC959.09c |apc5|SPAP32A8.01c|anaphase-promoting complex subunit Apc5 |Schizosaccharomyces pombe|chr 1|||Manual Length = 737 Score = 26.6 bits (56), Expect = 2.2 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 5/57 (8%) Frame = -2 Query: 333 FLWLSCFMDEWVFIN--LYKK---GFLYCKLRTNRIEKIMFLIFISLLNLSTEVKGI 178 F++LS +DE ++ LY K GF + K+ T R + + ISL NLS ++GI Sbjct: 506 FIYLSKAIDEKNHMDATLYLKNLNGFRHDKMSTFRTQLYALRLDISLGNLSQAIEGI 562 >SPAPJ698.03c |prp12|sap130|U2 snRNP-associated protein Sap130 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1206 Score = 26.2 bits (55), Expect = 3.0 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +2 Query: 218 KIRNIIFSILFVLNLQYRNPFLYRLIKTHSSIKHDSHRK 334 K NI F ++ L+ Y NP L +S I HDS R+ Sbjct: 168 KANNICFHLIG-LDTGYANPIFAALEVDYSEIDHDSTRE 205 >SPAC5D6.12 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 314 Score = 25.8 bits (54), Expect = 3.9 Identities = 15/73 (20%), Positives = 32/73 (43%), Gaps = 6/73 (8%) Frame = +2 Query: 107 SYPVYHDTTHIFVLESDCTFYKIIIP--FTSVDKFRREIKIRNIIFSILFVLNLQYRNPF 280 S P+ H+ E+D ++ + + FRR+ + + + + + L + NP Sbjct: 159 SSPLTVYRNHLLTCETDSALAQLFKSEIYQQLSDFRRDFPLSHALRDTMLIARLNFLNPM 218 Query: 281 L----YRLIKTHS 307 L ++ +K HS Sbjct: 219 LALSFFQAVKKHS 231 >SPAC1783.03 |fta2|sma2|Sim4 and Mal2 associated |Schizosaccharomyces pombe|chr 1|||Manual Length = 351 Score = 25.4 bits (53), Expect = 5.2 Identities = 15/45 (33%), Positives = 24/45 (53%), Gaps = 3/45 (6%) Frame = +2 Query: 128 TTHIFVLESDCTFYKII---IPFTSVDKFRREIKIRNIIFSILFV 253 T H F ES+ + + I + KF EIK+R I +++LF+ Sbjct: 160 TQHEFEAESEKIIHHSLKGDIEYLPSFKFLLEIKVRTIDYALLFI 204 >SPBC1289.15 ||SPBC8E4.07c|glycoprotein |Schizosaccharomyces pombe|chr 2|||Manual Length = 1283 Score = 25.0 bits (52), Expect = 6.8 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = -3 Query: 128 CRGTPDRNEVPYYKNINFKFYSRHKEFIKS*VRVIRV 18 C TP E P N+NF F+S++ F + +RVI V Sbjct: 1123 CSSTPFA-ECP---NLNFNFHSKNVNFPPADIRVISV 1155 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,248,819 Number of Sequences: 5004 Number of extensions: 48640 Number of successful extensions: 100 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 100 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 100 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 212331630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -