BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0169 (523 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 25 1.2 AB090821-1|BAC57917.1| 353|Anopheles gambiae gag-like protein p... 24 3.6 AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 23 6.2 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 25.4 bits (53), Expect = 1.2 Identities = 14/32 (43%), Positives = 17/32 (53%), Gaps = 3/32 (9%) Frame = -3 Query: 347 RSWAISCG---YRVLWTNGFLLICTKRDSCTA 261 +SWA G YR + NGFL I + R C A Sbjct: 204 QSWASPDGCIVYRCVKENGFLSISSSRKQCPA 235 >AB090821-1|BAC57917.1| 353|Anopheles gambiae gag-like protein protein. Length = 353 Score = 23.8 bits (49), Expect = 3.6 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -2 Query: 72 VLFEA*RVHKELSESNSGIH 13 VL+E R++ L E N G+H Sbjct: 144 VLYEKIRLNPRLQEENKGVH 163 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 23.0 bits (47), Expect = 6.2 Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 2/41 (4%) Frame = +3 Query: 402 LHRFTKRVLPYPQNYKLSRC*IFWCL--AHKIDHVSCFFNY 518 L+ +++ Y QN+ L R ++CL K+D FN+ Sbjct: 115 LYTTADKIIMYDQNHLLGRA--YFCLLEGDKMDQADAQFNF 153 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 554,851 Number of Sequences: 2352 Number of extensions: 11690 Number of successful extensions: 33 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 33 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -