BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0165 (520 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U71268-1|AAD00180.1| 575|Homo sapiens potential transcriptional... 29 9.8 U71267-1|AAD00179.1| 642|Homo sapiens potential transcriptional... 29 9.8 BC035590-1|AAH35590.1| 572|Homo sapiens CCR4-NOT transcription ... 29 9.8 AL389980-1|CAB97536.1| 572|Homo sapiens NOT4, potential transcr... 29 9.8 AK074671-1|BAC11125.1| 565|Homo sapiens protein ( Homo sapiens ... 29 9.8 >U71268-1|AAD00180.1| 575|Homo sapiens potential transcriptional repressor NOT4Hp protein. Length = 575 Score = 29.1 bits (62), Expect = 9.8 Identities = 18/40 (45%), Positives = 21/40 (52%) Frame = -1 Query: 211 VQDYPGISRVKLKQFSEHRIRVVGT*GSGKLSHSSAGTNA 92 VQD P +S L+ S H G GSG L H +A TNA Sbjct: 425 VQDQPSLSPTSLQNSSSHTTTAKGP-GSGFL-HPAAATNA 462 >U71267-1|AAD00179.1| 642|Homo sapiens potential transcriptional repressor NOT4Hp protein. Length = 642 Score = 29.1 bits (62), Expect = 9.8 Identities = 18/40 (45%), Positives = 21/40 (52%) Frame = -1 Query: 211 VQDYPGISRVKLKQFSEHRIRVVGT*GSGKLSHSSAGTNA 92 VQD P +S L+ S H G GSG L H +A TNA Sbjct: 425 VQDQPSLSPTSLQNSSSHTTTAKGP-GSGFL-HPAAATNA 462 >BC035590-1|AAH35590.1| 572|Homo sapiens CCR4-NOT transcription complex, subunit 4 protein. Length = 572 Score = 29.1 bits (62), Expect = 9.8 Identities = 18/40 (45%), Positives = 21/40 (52%) Frame = -1 Query: 211 VQDYPGISRVKLKQFSEHRIRVVGT*GSGKLSHSSAGTNA 92 VQD P +S L+ S H G GSG L H +A TNA Sbjct: 422 VQDQPSLSPTSLQNSSSHTTTAKGP-GSGFL-HPAAATNA 459 >AL389980-1|CAB97536.1| 572|Homo sapiens NOT4, potential transcriptional repressor, alternatively spliced product protein. Length = 572 Score = 29.1 bits (62), Expect = 9.8 Identities = 18/40 (45%), Positives = 21/40 (52%) Frame = -1 Query: 211 VQDYPGISRVKLKQFSEHRIRVVGT*GSGKLSHSSAGTNA 92 VQD P +S L+ S H G GSG L H +A TNA Sbjct: 422 VQDQPSLSPTSLQNSSSHTTTAKGP-GSGFL-HPAAATNA 459 >AK074671-1|BAC11125.1| 565|Homo sapiens protein ( Homo sapiens cDNA FLJ90190 fis, clone MAMMA1001094, highly similar to Human potential transcriptional repressor NOT4Hp (NOT4H) mRNA. ). Length = 565 Score = 29.1 bits (62), Expect = 9.8 Identities = 18/40 (45%), Positives = 21/40 (52%) Frame = -1 Query: 211 VQDYPGISRVKLKQFSEHRIRVVGT*GSGKLSHSSAGTNA 92 VQD P +S L+ S H G GSG L H +A TNA Sbjct: 223 VQDQPSLSPTSLQNSSSHTTTAKGP-GSGFL-HPAAATNA 260 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 75,029,679 Number of Sequences: 237096 Number of extensions: 1601416 Number of successful extensions: 7525 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7367 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7523 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4933413474 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -