BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0164 (524 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 22 3.8 AY453651-1|AAR89057.1| 199|Tribolium castaneum serrate protein. 22 3.8 AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory recept... 21 5.0 AM292346-1|CAL23158.2| 314|Tribolium castaneum gustatory recept... 21 5.0 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 21 8.8 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.8 bits (44), Expect = 3.8 Identities = 13/40 (32%), Positives = 17/40 (42%) Frame = -1 Query: 125 YPYWTHKSPPCLIVSLQKYLALQAPTHRSQFLPIFCVNYD 6 Y Y + P + VS+ + L H LP FC N D Sbjct: 94 YSYANGAAGP-IPVSMASKMGLAPTGHPGAALPFFCHNGD 132 >AY453651-1|AAR89057.1| 199|Tribolium castaneum serrate protein. Length = 199 Score = 21.8 bits (44), Expect = 3.8 Identities = 8/23 (34%), Positives = 11/23 (47%) Frame = +1 Query: 451 RGNAIYLESSHIYHLYSSNGASC 519 +G L+ SH H NG +C Sbjct: 137 KGKTCSLKDSHCDHTTCKNGGTC 159 >AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory receptor candidate 59 protein. Length = 489 Score = 21.4 bits (43), Expect = 5.0 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +3 Query: 84 NNKAWRRFMSPVRIIH 131 NN ++ F+S V IIH Sbjct: 209 NNGHYKNFLSQVEIIH 224 >AM292346-1|CAL23158.2| 314|Tribolium castaneum gustatory receptor candidate 25 protein. Length = 314 Score = 21.4 bits (43), Expect = 5.0 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +3 Query: 84 NNKAWRRFMSPVRIIH 131 NN ++ F+S V IIH Sbjct: 34 NNGHYKNFLSQVEIIH 49 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 20.6 bits (41), Expect = 8.8 Identities = 8/27 (29%), Positives = 13/27 (48%) Frame = -1 Query: 179 VYNHPLYTKLRSLLECMDYPYWTHKSP 99 +Y HPL+ L + E + T + P Sbjct: 80 IYGHPLFPLLALIFEKCELATCTPREP 106 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 129,233 Number of Sequences: 336 Number of extensions: 2866 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12678017 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -