BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0163 (460 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4A8.10 |||lipase |Schizosaccharomyces pombe|chr 1|||Manual 25 5.6 SPBC1652.02 |aap1|SPBC16A3.20c|APC amino acid transporter|Schizo... 25 7.3 >SPAC4A8.10 |||lipase |Schizosaccharomyces pombe|chr 1|||Manual Length = 723 Score = 25.0 bits (52), Expect = 5.6 Identities = 10/41 (24%), Positives = 19/41 (46%) Frame = -1 Query: 226 PVAGALMMTIFVGVRNNNVNFKCPAIRTGTASICIKIVNAQ 104 P + +++ VRN F+ A G ++C+ + N Q Sbjct: 99 PFINSTNSVLWIRVRNREARFRQAAYLQGPFTLCVSVWNDQ 139 >SPBC1652.02 |aap1|SPBC16A3.20c|APC amino acid transporter|Schizosaccharomyces pombe|chr 2|||Manual Length = 594 Score = 24.6 bits (51), Expect = 7.3 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +3 Query: 45 NARSSVGVLVRVVFYFIIFVCALTIFIHILAVP 143 N + ++ V+ VFY + F +TIF+ L VP Sbjct: 285 NPQRAIPSAVKKVFYRMGFFYIITIFLITLVVP 317 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,917,283 Number of Sequences: 5004 Number of extensions: 38979 Number of successful extensions: 69 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 69 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 69 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 172312850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -