BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0160 (522 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. 26 0.67 Z49833-1|CAA89994.1| 250|Anopheles gambiae serine proteinase pr... 23 4.7 >AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. Length = 1201 Score = 26.2 bits (55), Expect = 0.67 Identities = 16/57 (28%), Positives = 29/57 (50%) Frame = -2 Query: 191 EVSGGRRTSGCVXLALVIHVQKCFNVALRCWRRLVGADDGRHGAALGGVERAVDDGA 21 ++SGG+++ V LAL+ +QKC + + A D +H +A+ + D A Sbjct: 1098 QLSGGQKS--LVALALIFAIQKCDPAPFYLFDEIDQALDAQHRSAVADMIHEQSDRA 1152 >Z49833-1|CAA89994.1| 250|Anopheles gambiae serine proteinase protein. Length = 250 Score = 23.4 bits (48), Expect = 4.7 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +1 Query: 475 WFLNVVQIITADIYL 519 WFLNV+ IT D+ L Sbjct: 88 WFLNVLVFITNDVAL 102 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 427,762 Number of Sequences: 2352 Number of extensions: 6990 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -