BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0155 (676 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 23 2.0 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 23 3.5 AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 22 6.1 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 22 6.1 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 21 8.1 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 21 8.1 AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alph... 21 8.1 >DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monooxygenase protein. Length = 517 Score = 23.4 bits (48), Expect = 2.0 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +2 Query: 197 VGNHITTFLIAAYKHGYQATC 259 VG +T F AYK G ++TC Sbjct: 196 VGYKVTGFEELAYKMGLESTC 216 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 22.6 bits (46), Expect = 3.5 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -1 Query: 343 ATSIFKCLLSPCTDIKFFYFNV 278 A+S+F LL P + F YF + Sbjct: 11 ASSVFLSLLIPALILYFIYFRI 32 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.8 bits (44), Expect = 6.1 Identities = 6/17 (35%), Positives = 14/17 (82%) Frame = +1 Query: 598 MYRIINYSVKYILLETF 648 MY +NY+++ ++++TF Sbjct: 1 MYGFVNYALELLVVKTF 17 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.8 bits (44), Expect = 6.1 Identities = 6/17 (35%), Positives = 14/17 (82%) Frame = +1 Query: 598 MYRIINYSVKYILLETF 648 MY +NY+++ ++++TF Sbjct: 1 MYGFVNYALELLVVKTF 17 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 21.4 bits (43), Expect = 8.1 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = +1 Query: 37 VFYSYLKLKEQECRNIVWISECVAQKHRAKIDNY 138 V+ ++ + NI W +E A A ID+Y Sbjct: 40 VYNLLYRVAQPALANITWYNEGQAWNIEANIDSY 73 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 21.4 bits (43), Expect = 8.1 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = +1 Query: 37 VFYSYLKLKEQECRNIVWISECVAQKHRAKIDNY 138 V+ ++ + NI W +E A A ID+Y Sbjct: 40 VYNLLYRVAQPALANITWYNEGQAWNIEANIDSY 73 >AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alpha protein precursor protein. Length = 153 Score = 21.4 bits (43), Expect = 8.1 Identities = 7/21 (33%), Positives = 12/21 (57%) Frame = -1 Query: 358 FLKSIATSIFKCLLSPCTDIK 296 F K I + +C+ PCT ++ Sbjct: 102 FRKVITKAPLECMCRPCTSVE 122 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 178,056 Number of Sequences: 438 Number of extensions: 3397 Number of successful extensions: 9 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20464920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -