BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0155 (676 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g28715.1 68416.m03584 H+-transporting two-sector ATPase, puta... 64 6e-11 At3g28710.1 68416.m03583 H+-transporting two-sector ATPase, puta... 64 6e-11 At5g01190.1 68418.m00024 laccase, putative / diphenol oxidase, p... 29 2.8 >At3g28715.1 68416.m03584 H+-transporting two-sector ATPase, putative similar to SP|P54641 Vacuolar ATP synthase subunit d (EC 3.6.3.14) (Vacuolar proton pump d subunit) (V-ATPase 41 KDa accessory protein) {Dictyostelium discoideum}; contains Pfam profile PF01992: ATP synthase (C/AC39) subunit Length = 351 Score = 64.5 bits (150), Expect = 6e-11 Identities = 26/48 (54%), Positives = 40/48 (83%), Gaps = 1/48 (2%) Frame = +1 Query: 10 AFLQQFHFGVFYSYLKLKEQECRNIVWISECVAQKHRAKI-DNYIPIF 150 AF QQFH+ VF++Y++L+EQE RN++WISECVAQ +++I D+ + +F Sbjct: 304 AFEQQFHYAVFFAYMRLREQEIRNLMWISECVAQNQKSRIHDSVVYMF 351 >At3g28710.1 68416.m03583 H+-transporting two-sector ATPase, putative similar to SP|P54641 Vacuolar ATP synthase subunit d (EC 3.6.3.14) (Vacuolar proton pump d subunit) (V-ATPase 41 KDa accessory protein) {Dictyostelium discoideum}; contains Pfam profile PF01992: ATP synthase (C/AC39) subunit Length = 351 Score = 64.5 bits (150), Expect = 6e-11 Identities = 26/48 (54%), Positives = 40/48 (83%), Gaps = 1/48 (2%) Frame = +1 Query: 10 AFLQQFHFGVFYSYLKLKEQECRNIVWISECVAQKHRAKI-DNYIPIF 150 AF QQFH+ VF++Y++L+EQE RN++WISECVAQ +++I D+ + +F Sbjct: 304 AFEQQFHYAVFFAYMRLREQEIRNLMWISECVAQNQKSRIHDSVVYMF 351 >At5g01190.1 68418.m00024 laccase, putative / diphenol oxidase, putative similar to diphenol oxidase [Nicotiana tabacum][GI:1685087] Length = 553 Score = 29.1 bits (62), Expect = 2.8 Identities = 13/42 (30%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = -2 Query: 312 HALISNFSISMSGGTEWW--HVAW*PCLYAAIKKVVIWFPTM 193 H+ + NF+++ GT WW HV W L A + ++ P + Sbjct: 107 HSYVYNFTVTGQRGTLWWHAHVLW---LRATVHGAIVILPKL 145 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,182,512 Number of Sequences: 28952 Number of extensions: 250586 Number of successful extensions: 501 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 497 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 501 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1432596384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -