BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0154 (695 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 151 7e-37 SB_54557| Best HMM Match : PHK_AB (HMM E-Value=0) 104 6e-23 SB_56156| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 1e-22 SB_55462| Best HMM Match : Histone (HMM E-Value=4.8e-33) 103 1e-22 SB_46252| Best HMM Match : Histone (HMM E-Value=4.8e-33) 103 1e-22 SB_1105| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 1e-22 SB_26809| Best HMM Match : Histone (HMM E-Value=4.8e-33) 103 1e-22 SB_25701| Best HMM Match : Histone (HMM E-Value=4.8e-33) 103 1e-22 SB_54197| Best HMM Match : Histone (HMM E-Value=9.4e-33) 103 1e-22 SB_32396| Best HMM Match : Histone (HMM E-Value=9.4e-33) 103 1e-22 SB_32212| Best HMM Match : Histone (HMM E-Value=9.4e-33) 103 1e-22 SB_31835| Best HMM Match : Histone (HMM E-Value=9.4e-33) 103 1e-22 SB_28838| Best HMM Match : Histone (HMM E-Value=9.4e-33) 103 1e-22 SB_14747| Best HMM Match : Histone (HMM E-Value=9.4e-33) 103 1e-22 SB_55892| Best HMM Match : Histone (HMM E-Value=9.4e-33) 103 1e-22 SB_54707| Best HMM Match : Histone (HMM E-Value=9.4e-33) 103 1e-22 SB_54382| Best HMM Match : Histone (HMM E-Value=9.4e-33) 103 1e-22 SB_45182| Best HMM Match : Histone (HMM E-Value=9.4e-33) 103 1e-22 SB_42476| Best HMM Match : Histone (HMM E-Value=9.4e-33) 103 1e-22 SB_25226| Best HMM Match : Histone (HMM E-Value=9.4e-33) 103 1e-22 SB_19336| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 1e-22 SB_11028| Best HMM Match : Histone (HMM E-Value=9.4e-33) 103 1e-22 SB_9842| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 1e-22 SB_8583| Best HMM Match : Histone (HMM E-Value=9.4e-33) 103 1e-22 SB_8319| Best HMM Match : Histone (HMM E-Value=9.4e-33) 103 1e-22 SB_7498| Best HMM Match : Histone (HMM E-Value=9.4e-33) 103 1e-22 SB_48204| Best HMM Match : Histone (HMM E-Value=2.7e-32) 101 6e-22 SB_29633| Best HMM Match : Histone (HMM E-Value=5.3e-31) 101 6e-22 SB_5065| Best HMM Match : Histone (HMM E-Value=2.6e-33) 99 2e-21 SB_1956| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_38873| Best HMM Match : Histone (HMM E-Value=2.6e-33) 99 2e-21 SB_24673| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_57971| Best HMM Match : Histone (HMM E-Value=5.4e-33) 100 2e-21 SB_31727| Best HMM Match : Histone (HMM E-Value=5e-33) 100 2e-21 SB_3888| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 5e-21 SB_18628| Best HMM Match : Histone (HMM E-Value=1.5e-31) 97 1e-20 SB_56326| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 2e-16 SB_28189| Best HMM Match : Histone (HMM E-Value=1.5e-12) 80 2e-15 SB_58649| Best HMM Match : Histone (HMM E-Value=4.5e-12) 75 6e-14 SB_31723| Best HMM Match : Histone (HMM E-Value=0.016) 68 8e-12 SB_44162| Best HMM Match : Histone (HMM E-Value=0.00016) 64 8e-11 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 63 2e-10 SB_30055| Best HMM Match : Histone (HMM E-Value=0.97) 46 2e-05 SB_55494| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_44025| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.22 SB_38686| Best HMM Match : 7tm_1 (HMM E-Value=5.70048e-42) 29 2.7 SB_39243| Best HMM Match : HTH_7 (HMM E-Value=0.035) 29 2.7 SB_35253| Best HMM Match : Extensin_2 (HMM E-Value=0.078) 28 6.3 SB_31174| Best HMM Match : LIM_bind (HMM E-Value=0) 28 6.3 SB_30489| Best HMM Match : HEAT (HMM E-Value=9.2e-17) 28 6.3 SB_16639| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_25269| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_27184| Best HMM Match : 7tm_1 (HMM E-Value=1.8e-05) 28 8.3 SB_39750| Best HMM Match : Borrelia_orfA (HMM E-Value=1.1) 28 8.3 SB_22486| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 151 bits (365), Expect = 7e-37 Identities = 73/73 (100%), Positives = 73/73 (100%) Frame = +1 Query: 37 GLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITP 216 GLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITP Sbjct: 95 GLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITP 154 Query: 217 RHLQLAIRGDEEL 255 RHLQLAIRGDEEL Sbjct: 155 RHLQLAIRGDEEL 167 Score = 29.9 bits (64), Expect = 2.1 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = +3 Query: 252 IDSLIKATIAGGGV 293 +DSLIKATIAGGGV Sbjct: 167 LDSLIKATIAGGGV 180 >SB_54557| Best HMM Match : PHK_AB (HMM E-Value=0) Length = 863 Score = 104 bits (250), Expect = 6e-23 Identities = 52/84 (61%), Positives = 65/84 (77%) Frame = +1 Query: 37 GLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITP 216 GLQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K RI P Sbjct: 759 GLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKTRIIP 817 Query: 217 RHLQLAIRGDEELTAS*KQLSLAE 288 RHLQLA+R DEEL + +++A+ Sbjct: 818 RHLQLAVRNDEELNRLLRGVTIAQ 841 >SB_56156| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 103 bits (248), Expect = 1e-22 Identities = 51/73 (69%), Positives = 59/73 (80%) Frame = +1 Query: 37 GLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITP 216 GLQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K RI P Sbjct: 22 GLQFPVGRIHRHLRKGNYAE-RVGAGAPVYMAAVLEYLSAEILELAGNAARDNKKTRIIP 80 Query: 217 RHLQLAIRGDEEL 255 RHLQLA+R DEEL Sbjct: 81 RHLQLAVRNDEEL 93 >SB_55462| Best HMM Match : Histone (HMM E-Value=4.8e-33) Length = 126 Score = 103 bits (248), Expect = 1e-22 Identities = 51/73 (69%), Positives = 59/73 (80%) Frame = +1 Query: 37 GLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITP 216 GLQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K RI P Sbjct: 22 GLQFPVGRIHRHLRKGNYAE-RVGAGAPVYMAAVLEYLSAEILELAGNAARDNKKTRIIP 80 Query: 217 RHLQLAIRGDEEL 255 RHLQLA+R DEEL Sbjct: 81 RHLQLAVRNDEEL 93 >SB_46252| Best HMM Match : Histone (HMM E-Value=4.8e-33) Length = 134 Score = 103 bits (248), Expect = 1e-22 Identities = 51/73 (69%), Positives = 59/73 (80%) Frame = +1 Query: 37 GLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITP 216 GLQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K RI P Sbjct: 30 GLQFPVGRIHRHLRKGNYAE-RVGAGAPVYMAAVLEYLSAEILELAGNAARDNKKTRIIP 88 Query: 217 RHLQLAIRGDEEL 255 RHLQLA+R DEEL Sbjct: 89 RHLQLAVRNDEEL 101 >SB_1105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 496 Score = 103 bits (248), Expect = 1e-22 Identities = 51/73 (69%), Positives = 59/73 (80%) Frame = +1 Query: 37 GLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITP 216 GLQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K RI P Sbjct: 392 GLQFPVGRIHRHLRKGNYAE-RVGAGAPVYMAAVLEYLSAEILELAGNAARDNKKTRIIP 450 Query: 217 RHLQLAIRGDEEL 255 RHLQLA+R DEEL Sbjct: 451 RHLQLAVRNDEEL 463 >SB_26809| Best HMM Match : Histone (HMM E-Value=4.8e-33) Length = 126 Score = 103 bits (248), Expect = 1e-22 Identities = 51/73 (69%), Positives = 59/73 (80%) Frame = +1 Query: 37 GLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITP 216 GLQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K RI P Sbjct: 22 GLQFPVGRIHRHLRKGNYAE-RVGAGAPVYMAAVLEYLSAEILELAGNAARDNKKTRIIP 80 Query: 217 RHLQLAIRGDEEL 255 RHLQLA+R DEEL Sbjct: 81 RHLQLAVRNDEEL 93 >SB_25701| Best HMM Match : Histone (HMM E-Value=4.8e-33) Length = 126 Score = 103 bits (248), Expect = 1e-22 Identities = 51/73 (69%), Positives = 59/73 (80%) Frame = +1 Query: 37 GLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITP 216 GLQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K RI P Sbjct: 22 GLQFPVGRIHRHLRKGNYAE-RVGAGAPVYMAAVLEYLSAEILELAGNAARDNKKTRIIP 80 Query: 217 RHLQLAIRGDEEL 255 RHLQLA+R DEEL Sbjct: 81 RHLQLAVRNDEEL 93 >SB_54197| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 103 bits (247), Expect = 1e-22 Identities = 51/73 (69%), Positives = 59/73 (80%) Frame = +1 Query: 37 GLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITP 216 GLQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K RI P Sbjct: 22 GLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKTRIIP 80 Query: 217 RHLQLAIRGDEEL 255 RHLQLA+R DEEL Sbjct: 81 RHLQLAVRNDEEL 93 >SB_32396| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 103 bits (247), Expect = 1e-22 Identities = 51/73 (69%), Positives = 59/73 (80%) Frame = +1 Query: 37 GLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITP 216 GLQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K RI P Sbjct: 22 GLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKTRIIP 80 Query: 217 RHLQLAIRGDEEL 255 RHLQLA+R DEEL Sbjct: 81 RHLQLAVRNDEEL 93 >SB_32212| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 103 bits (247), Expect = 1e-22 Identities = 51/73 (69%), Positives = 59/73 (80%) Frame = +1 Query: 37 GLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITP 216 GLQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K RI P Sbjct: 22 GLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKTRIIP 80 Query: 217 RHLQLAIRGDEEL 255 RHLQLA+R DEEL Sbjct: 81 RHLQLAVRNDEEL 93 Score = 29.1 bits (62), Expect = 3.6 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = +3 Query: 270 ATIAGGGVIPHIHKSLIGKK 329 ATIA GGV+P+I SL+ KK Sbjct: 100 ATIAQGGVLPNIQASLLPKK 119 >SB_31835| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 103 bits (247), Expect = 1e-22 Identities = 51/73 (69%), Positives = 59/73 (80%) Frame = +1 Query: 37 GLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITP 216 GLQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K RI P Sbjct: 22 GLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKTRIIP 80 Query: 217 RHLQLAIRGDEEL 255 RHLQLA+R DEEL Sbjct: 81 RHLQLAVRNDEEL 93 >SB_28838| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 103 bits (247), Expect = 1e-22 Identities = 51/73 (69%), Positives = 59/73 (80%) Frame = +1 Query: 37 GLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITP 216 GLQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K RI P Sbjct: 22 GLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKTRIIP 80 Query: 217 RHLQLAIRGDEEL 255 RHLQLA+R DEEL Sbjct: 81 RHLQLAVRNDEEL 93 >SB_14747| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 103 bits (247), Expect = 1e-22 Identities = 51/73 (69%), Positives = 59/73 (80%) Frame = +1 Query: 37 GLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITP 216 GLQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K RI P Sbjct: 22 GLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKTRIIP 80 Query: 217 RHLQLAIRGDEEL 255 RHLQLA+R DEEL Sbjct: 81 RHLQLAVRNDEEL 93 >SB_55892| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 103 bits (247), Expect = 1e-22 Identities = 51/73 (69%), Positives = 59/73 (80%) Frame = +1 Query: 37 GLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITP 216 GLQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K RI P Sbjct: 22 GLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKTRIIP 80 Query: 217 RHLQLAIRGDEEL 255 RHLQLA+R DEEL Sbjct: 81 RHLQLAVRNDEEL 93 >SB_54707| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 126 Score = 103 bits (247), Expect = 1e-22 Identities = 51/73 (69%), Positives = 59/73 (80%) Frame = +1 Query: 37 GLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITP 216 GLQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K RI P Sbjct: 22 GLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKTRIIP 80 Query: 217 RHLQLAIRGDEEL 255 RHLQLA+R DEEL Sbjct: 81 RHLQLAVRNDEEL 93 >SB_54382| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 103 bits (247), Expect = 1e-22 Identities = 51/73 (69%), Positives = 59/73 (80%) Frame = +1 Query: 37 GLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITP 216 GLQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K RI P Sbjct: 22 GLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKTRIIP 80 Query: 217 RHLQLAIRGDEEL 255 RHLQLA+R DEEL Sbjct: 81 RHLQLAVRNDEEL 93 >SB_45182| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 103 bits (247), Expect = 1e-22 Identities = 51/73 (69%), Positives = 59/73 (80%) Frame = +1 Query: 37 GLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITP 216 GLQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K RI P Sbjct: 22 GLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKTRIIP 80 Query: 217 RHLQLAIRGDEEL 255 RHLQLA+R DEEL Sbjct: 81 RHLQLAVRNDEEL 93 >SB_42476| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 103 bits (247), Expect = 1e-22 Identities = 51/73 (69%), Positives = 59/73 (80%) Frame = +1 Query: 37 GLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITP 216 GLQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K RI P Sbjct: 22 GLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKTRIIP 80 Query: 217 RHLQLAIRGDEEL 255 RHLQLA+R DEEL Sbjct: 81 RHLQLAVRNDEEL 93 >SB_25226| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 103 bits (247), Expect = 1e-22 Identities = 51/73 (69%), Positives = 59/73 (80%) Frame = +1 Query: 37 GLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITP 216 GLQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K RI P Sbjct: 22 GLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKTRIIP 80 Query: 217 RHLQLAIRGDEEL 255 RHLQLA+R DEEL Sbjct: 81 RHLQLAVRNDEEL 93 >SB_19336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 103 bits (247), Expect = 1e-22 Identities = 51/73 (69%), Positives = 59/73 (80%) Frame = +1 Query: 37 GLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITP 216 GLQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K RI P Sbjct: 22 GLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKTRIIP 80 Query: 217 RHLQLAIRGDEEL 255 RHLQLA+R DEEL Sbjct: 81 RHLQLAVRNDEEL 93 >SB_11028| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 103 bits (247), Expect = 1e-22 Identities = 51/73 (69%), Positives = 59/73 (80%) Frame = +1 Query: 37 GLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITP 216 GLQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K RI P Sbjct: 22 GLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKTRIIP 80 Query: 217 RHLQLAIRGDEEL 255 RHLQLA+R DEEL Sbjct: 81 RHLQLAVRNDEEL 93 >SB_9842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 103 bits (247), Expect = 1e-22 Identities = 51/73 (69%), Positives = 59/73 (80%) Frame = +1 Query: 37 GLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITP 216 GLQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K RI P Sbjct: 22 GLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKTRIIP 80 Query: 217 RHLQLAIRGDEEL 255 RHLQLA+R DEEL Sbjct: 81 RHLQLAVRNDEEL 93 >SB_8583| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 103 bits (247), Expect = 1e-22 Identities = 51/73 (69%), Positives = 59/73 (80%) Frame = +1 Query: 37 GLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITP 216 GLQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K RI P Sbjct: 22 GLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKTRIIP 80 Query: 217 RHLQLAIRGDEEL 255 RHLQLA+R DEEL Sbjct: 81 RHLQLAVRNDEEL 93 >SB_8319| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 103 bits (247), Expect = 1e-22 Identities = 51/73 (69%), Positives = 59/73 (80%) Frame = +1 Query: 37 GLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITP 216 GLQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K RI P Sbjct: 22 GLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKTRIIP 80 Query: 217 RHLQLAIRGDEEL 255 RHLQLA+R DEEL Sbjct: 81 RHLQLAVRNDEEL 93 >SB_7498| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 103 bits (247), Expect = 1e-22 Identities = 51/73 (69%), Positives = 59/73 (80%) Frame = +1 Query: 37 GLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITP 216 GLQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K RI P Sbjct: 22 GLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKTRIIP 80 Query: 217 RHLQLAIRGDEEL 255 RHLQLA+R DEEL Sbjct: 81 RHLQLAVRNDEEL 93 >SB_48204| Best HMM Match : Histone (HMM E-Value=2.7e-32) Length = 125 Score = 101 bits (242), Expect = 6e-22 Identities = 51/73 (69%), Positives = 58/73 (79%) Frame = +1 Query: 37 GLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITP 216 GLQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA+ D K RI P Sbjct: 22 GLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAACDNKKTRIIP 80 Query: 217 RHLQLAIRGDEEL 255 RHLQLA+R DEEL Sbjct: 81 RHLQLAVRNDEEL 93 >SB_29633| Best HMM Match : Histone (HMM E-Value=5.3e-31) Length = 125 Score = 101 bits (242), Expect = 6e-22 Identities = 50/73 (68%), Positives = 59/73 (80%) Frame = +1 Query: 37 GLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITP 216 GLQFPVGRIHRHL+ + RVGA A V+ AA+LEYL+AE+LELAGNA++D K RI P Sbjct: 22 GLQFPVGRIHRHLRKGNYAE-RVGAGAPVHLAAVLEYLSAEILELAGNAARDNKKTRIIP 80 Query: 217 RHLQLAIRGDEEL 255 RHLQLA+R DEEL Sbjct: 81 RHLQLAVRNDEEL 93 >SB_5065| Best HMM Match : Histone (HMM E-Value=2.6e-33) Length = 330 Score = 99 bits (238), Expect = 2e-21 Identities = 49/73 (67%), Positives = 58/73 (79%) Frame = +1 Query: 37 GLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITP 216 GLQFPVGR+HR L+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K RI P Sbjct: 22 GLQFPVGRVHRFLRKGNYAE-RVGAGAPVYMAAVLEYLSAEILELAGNAARDNKKTRIIP 80 Query: 217 RHLQLAIRGDEEL 255 RHLQLA+R DEEL Sbjct: 81 RHLQLAVRNDEEL 93 >SB_1956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 99 bits (238), Expect = 2e-21 Identities = 49/73 (67%), Positives = 58/73 (79%) Frame = +1 Query: 37 GLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITP 216 GLQFPVGR+HR L+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K RI P Sbjct: 22 GLQFPVGRVHRFLRKGNYAE-RVGAGAPVYMAAVLEYLSAEILELAGNAARDNKKTRIIP 80 Query: 217 RHLQLAIRGDEEL 255 RHLQLA+R DEEL Sbjct: 81 RHLQLAVRNDEEL 93 >SB_38873| Best HMM Match : Histone (HMM E-Value=2.6e-33) Length = 125 Score = 99 bits (238), Expect = 2e-21 Identities = 49/73 (67%), Positives = 58/73 (79%) Frame = +1 Query: 37 GLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITP 216 GLQFPVGR+HR L+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K RI P Sbjct: 22 GLQFPVGRVHRFLRKGNYAE-RVGAGAPVYMAAVLEYLSAEILELAGNAARDNKKTRIIP 80 Query: 217 RHLQLAIRGDEEL 255 RHLQLA+R DEEL Sbjct: 81 RHLQLAVRNDEEL 93 >SB_24673| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 732 Score = 99 bits (238), Expect = 2e-21 Identities = 49/73 (67%), Positives = 58/73 (79%) Frame = +1 Query: 37 GLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITP 216 GLQFPVGR+HR L+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K RI P Sbjct: 22 GLQFPVGRVHRFLRKGNYAE-RVGAGAPVYMAAVLEYLSAEILELAGNAARDNKKTRIIP 80 Query: 217 RHLQLAIRGDEEL 255 RHLQLA+R DEEL Sbjct: 81 RHLQLAVRNDEEL 93 >SB_57971| Best HMM Match : Histone (HMM E-Value=5.4e-33) Length = 125 Score = 99.5 bits (237), Expect = 2e-21 Identities = 49/73 (67%), Positives = 58/73 (79%) Frame = +1 Query: 37 GLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITP 216 GLQFPVGR+HR L+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K RI P Sbjct: 22 GLQFPVGRVHRFLRKGNYAK-RVGAGAPVYMAAVLEYLSAEILELAGNAARDNKKTRIIP 80 Query: 217 RHLQLAIRGDEEL 255 RHLQLA+R DEEL Sbjct: 81 RHLQLAVRNDEEL 93 >SB_31727| Best HMM Match : Histone (HMM E-Value=5e-33) Length = 126 Score = 99.5 bits (237), Expect = 2e-21 Identities = 50/73 (68%), Positives = 58/73 (79%) Frame = +1 Query: 37 GLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITP 216 GLQFPVGRIHR L+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K RI P Sbjct: 22 GLQFPVGRIHRLLRKGNYAE-RVGAGAPVYMAAVLEYLSAEILELAGNAARDNKKTRIIP 80 Query: 217 RHLQLAIRGDEEL 255 RHLQLA+R DEEL Sbjct: 81 RHLQLAVRNDEEL 93 >SB_3888| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 986 Score = 98.3 bits (234), Expect = 5e-21 Identities = 54/111 (48%), Positives = 72/111 (64%), Gaps = 3/111 (2%) Frame = +1 Query: 37 GLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITP 216 GLQFPV R+HR+L+ + T H R+ A A VY AA++EYLTAE+LELAGNA++D K RI P Sbjct: 657 GLQFPVSRVHRYLR-KCTHHYRISAAAPVYQAAVMEYLTAEILELAGNAARDNKKTRIIP 715 Query: 217 RHLQLAIRGDEELTAS*KQLSLAEAS--SHTYTNLSLERK-AVLVHPFNFK 360 RH+ LA+ DEEL K +++A + + L +RK LV P K Sbjct: 716 RHILLAVANDEELHKLLKGVTIASGGVLPNIHPELLKKRKGGKLVSPEELK 766 >SB_18628| Best HMM Match : Histone (HMM E-Value=1.5e-31) Length = 126 Score = 97.1 bits (231), Expect = 1e-20 Identities = 49/73 (67%), Positives = 57/73 (78%) Frame = +1 Query: 37 GLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITP 216 GLQFPVGRIHR L+ + RVGA VY AA+LEYL+AE+LELAGNA++D K RI P Sbjct: 22 GLQFPVGRIHRLLRKGNYAE-RVGAGDPVYMAAVLEYLSAEILELAGNAARDNKKTRIIP 80 Query: 217 RHLQLAIRGDEEL 255 RHLQLA+R DEEL Sbjct: 81 RHLQLAVRNDEEL 93 >SB_56326| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 83.0 bits (196), Expect = 2e-16 Identities = 40/63 (63%), Positives = 50/63 (79%) Frame = +1 Query: 100 RVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELTAS*KQLS 279 RVGA A VY AA+LEYLTAE+LELAGNA++D K RI PRHLQLA+R DEEL + ++ Sbjct: 6 RVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKSRIVPRHLQLAVRNDEELNKLLQGVT 65 Query: 280 LAE 288 +A+ Sbjct: 66 IAQ 68 >SB_28189| Best HMM Match : Histone (HMM E-Value=1.5e-12) Length = 90 Score = 79.8 bits (188), Expect = 2e-15 Identities = 38/52 (73%), Positives = 44/52 (84%) Frame = +1 Query: 100 RVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEEL 255 RVGA A VY AA+LEYL+AE+LELAGNA++D K RI PRHLQLA+R DEEL Sbjct: 6 RVGAGAPVYMAAVLEYLSAEILELAGNAARDNKKTRIIPRHLQLAVRNDEEL 57 >SB_58649| Best HMM Match : Histone (HMM E-Value=4.5e-12) Length = 74 Score = 74.9 bits (176), Expect = 6e-14 Identities = 36/54 (66%), Positives = 44/54 (81%) Frame = +1 Query: 37 GLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK 198 GLQFP+GRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++D K Sbjct: 22 GLQFPIGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAARDNK 74 >SB_31723| Best HMM Match : Histone (HMM E-Value=0.016) Length = 76 Score = 67.7 bits (158), Expect = 8e-12 Identities = 31/42 (73%), Positives = 37/42 (88%) Frame = +1 Query: 130 AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEEL 255 AA+LEYL+AE+LELAGNA++D K RI PRHLQLA+R DEEL Sbjct: 2 AAVLEYLSAEILELAGNAARDNKKTRIIPRHLQLAVRNDEEL 43 >SB_44162| Best HMM Match : Histone (HMM E-Value=0.00016) Length = 67 Score = 64.5 bits (150), Expect = 8e-11 Identities = 32/46 (69%), Positives = 37/46 (80%) Frame = +1 Query: 37 GLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELA 174 GLQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELA Sbjct: 22 GLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELA 66 >SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) Length = 150 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = +1 Query: 139 LEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEEL 255 LEYL+AE+LELAGNA++D K RI PRHLQLA+R DEEL Sbjct: 2 LEYLSAEILELAGNAARDNKKTRIIPRHLQLAVRNDEEL 40 >SB_30055| Best HMM Match : Histone (HMM E-Value=0.97) Length = 129 Score = 46.4 bits (105), Expect = 2e-05 Identities = 23/35 (65%), Positives = 26/35 (74%) Frame = +1 Query: 37 GLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAIL 141 GLQFPVGRIHRHL+ + RVGA A VY AA+L Sbjct: 95 GLQFPVGRIHRHLRKGNYAE-RVGAGAPVYMAAVL 128 >SB_55494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 664 Score = 38.3 bits (85), Expect = 0.006 Identities = 25/73 (34%), Positives = 37/73 (50%) Frame = +1 Query: 37 GLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITP 216 GL FPVGRI R L + + RV AA+Y AA LEY+ E + A + + + P Sbjct: 71 GLVFPVGRIFRWLLDMKVAC-RVYDAAAIYLAATLEYIAEETIYRAVTTRE--VIDHVVP 127 Query: 217 RHLQLAIRGDEEL 255 ++ + D +L Sbjct: 128 ETVEKCVNMDPDL 140 >SB_44025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 35 Score = 33.1 bits (72), Expect = 0.22 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 37 GLQFPVGRIHRHL 75 GLQFPVGRIHRHL Sbjct: 22 GLQFPVGRIHRHL 34 >SB_38686| Best HMM Match : 7tm_1 (HMM E-Value=5.70048e-42) Length = 366 Score = 29.5 bits (63), Expect = 2.7 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +1 Query: 271 QLSLAEASSHTYTNLSLERKAVLVHPFNFKL 363 Q +L S T+T ++LER ++HPF KL Sbjct: 119 QDALVSVSVFTFTAIALERYRAIIHPFKPKL 149 >SB_39243| Best HMM Match : HTH_7 (HMM E-Value=0.035) Length = 694 Score = 29.5 bits (63), Expect = 2.7 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = -2 Query: 553 ISLFSTYFYYL*LHISPDQQFQSHHCPLH*YYF 455 ISLFS+ FY++ LH+ D H LH Y F Sbjct: 531 ISLFSSLFYFMELHLLLDSDSDIHMYALH-YVF 562 >SB_35253| Best HMM Match : Extensin_2 (HMM E-Value=0.078) Length = 585 Score = 28.3 bits (60), Expect = 6.3 Identities = 19/59 (32%), Positives = 26/59 (44%) Frame = -3 Query: 657 YNDTAMHIPTSYIQNFKCPMNKQKLSLILIQSYFKSPYSLHISITYSYILVRTNSSSHT 481 Y T IP+ N K + + KL+ I SY S LH+ Y + RT S+T Sbjct: 460 YQVTRTAIPSYTYSNTKLHVQRYKLTRTTIPSYTYSNTKLHVQ---QYQVTRTTMPSYT 515 >SB_31174| Best HMM Match : LIM_bind (HMM E-Value=0) Length = 609 Score = 28.3 bits (60), Expect = 6.3 Identities = 17/69 (24%), Positives = 35/69 (50%), Gaps = 2/69 (2%) Frame = -3 Query: 573 LIQSYFKSPYSLHISITYSYILVRTNSSSHTTVHF--TNIILIENYVNQSGR*FVQVCYD 400 LI YF+S + ++ Y ++L S +TT+ N +I +++ + +VC + Sbjct: 395 LIPRYFRSIFEGGVTELYYHLLQPKESYHNTTITLDCENTTMITSHIKPV---YTKVCTE 451 Query: 399 GRYQMQYNF 373 GR +++ F Sbjct: 452 GRLILEFTF 460 >SB_30489| Best HMM Match : HEAT (HMM E-Value=9.2e-17) Length = 722 Score = 28.3 bits (60), Expect = 6.3 Identities = 19/60 (31%), Positives = 27/60 (45%), Gaps = 3/60 (5%) Frame = -3 Query: 246 ISSNSKL*VPRSNTLHF*IFRRISR---QLQNLCCKIFQNSGRINCCRSSYAPVACCPIL 76 +SSN L V + +F R +R Q Q LCC++ Q GR RS + C + Sbjct: 257 LSSNRVLPVKLAAARTLCVFIRYNRRYEQRQELCCRLIQECGRGKSYRSRLLFIDICKFI 316 >SB_16639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 358 Score = 28.3 bits (60), Expect = 6.3 Identities = 12/38 (31%), Positives = 23/38 (60%) Frame = +1 Query: 271 QLSLAEASSHTYTNLSLERKAVLVHPFNFKL*DDKIIL 384 Q +L S +T+ ++LER +++PF KL K+++ Sbjct: 115 QDALVSVSVYTFVVIALERYRAIINPFKPKLSKSKVLI 152 >SB_25269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 871 Score = 28.3 bits (60), Expect = 6.3 Identities = 17/59 (28%), Positives = 24/59 (40%), Gaps = 3/59 (5%) Frame = -1 Query: 428 GDDLCRCVTTAGIKCSIILSSHNLKLNGCTRTAFLSNERFVYVWDDAS---ASDSCFYE 261 G CR + T G +C ++ S K N C F + F + +A DSC E Sbjct: 632 GSITCRIIKTVGDRCLDLVPSRIFKHNSCGIALFQNTYMFFFEGSNADCFPVHDSCAKE 690 >SB_27184| Best HMM Match : 7tm_1 (HMM E-Value=1.8e-05) Length = 170 Score = 27.9 bits (59), Expect = 8.3 Identities = 16/35 (45%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = +1 Query: 280 LAEASSHTYTNLSLERKAVLVHP--FNFKL*DDKI 378 L ASS T T L++ER +VHP FKL D + Sbjct: 91 LTTASSFTLTVLAVERYQAIVHPMCMRFKLRDGAV 125 >SB_39750| Best HMM Match : Borrelia_orfA (HMM E-Value=1.1) Length = 810 Score = 27.9 bits (59), Expect = 8.3 Identities = 21/83 (25%), Positives = 40/83 (48%), Gaps = 2/83 (2%) Frame = +1 Query: 100 RVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELTAS*KQLS 279 RV + V++ A+ + +V + + + V + HL++ D+E + K LS Sbjct: 620 RVIGSCHVWARALEDSFLKQVWHMPWSTIRSKSVLVLDLGHLKIKSDPDQERVITTKNLS 679 Query: 280 LAEASSHTYT--NLSLERKAVLV 342 +AE S Y ++ LE+ VL+ Sbjct: 680 MAELESKCYDKFDIRLEQLQVLL 702 >SB_22486| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 497 Score = 27.9 bits (59), Expect = 8.3 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +1 Query: 283 AEASSHTYTNLSLERKAVLVHPFNFKL 363 A ++S T T LSL+R V++HPF +L Sbjct: 118 ATSASLTLTVLSLDRYRVIMHPFQERL 144 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,923,784 Number of Sequences: 59808 Number of extensions: 441855 Number of successful extensions: 1135 Number of sequences better than 10.0: 55 Number of HSP's better than 10.0 without gapping: 937 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1093 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1817559367 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -