BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0153 (689 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex det... 26 0.39 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 24 1.2 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 24 1.6 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 23 2.1 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 23 3.6 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 23 3.6 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 23 3.6 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 23 3.6 AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 23 3.6 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 23 3.6 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 23 3.6 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 22 4.8 AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 22 4.8 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 22 6.3 DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex det... 21 8.4 DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex det... 21 8.4 DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex det... 21 8.4 DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex det... 21 8.4 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 21 8.4 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 21 8.4 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 21 8.4 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 21 8.4 >DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 25.8 bits (54), Expect = 0.39 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +1 Query: 64 DFYNTRKNYMSVRKSLKYGLNYNDYVP 144 ++ N NY + K L Y +NY + +P Sbjct: 93 NYNNYNNNYNNYNKKLYYNINYIEQIP 119 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 24.2 bits (50), Expect = 1.2 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +1 Query: 64 DFYNTRKNYMSVRKSLKYGLNYNDYVP 144 ++ N NY + K L Y +NY + +P Sbjct: 336 NYNNYNNNYNNNYKKLYYNINYIEQIP 362 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 23.8 bits (49), Expect = 1.6 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = +2 Query: 464 CDRKNYSYPKLITTNLKNFEKLYPRIII 547 CDRK+ S K+I + + + K + I+ Sbjct: 6 CDRKSLSQRKIIRSRSRRYSKRFSSSIV 33 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 23.4 bits (48), Expect = 2.1 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +2 Query: 182 AEVHYNTTYLHLPVLGIQN 238 A V Y + + H+PV+GI + Sbjct: 112 AAVSYTSGFYHIPVIGISS 130 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 22.6 bits (46), Expect = 3.6 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +1 Query: 55 YVFDFYNTRKNYMSVRKSLKYGLNYNDYVP 144 Y +++ N NY + K L Y +NY + +P Sbjct: 96 YKYNYNNN--NYNNNCKKLYYNINYIEQIP 123 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 22.6 bits (46), Expect = 3.6 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +1 Query: 55 YVFDFYNTRKNYMSVRKSLKYGLNYNDYVP 144 Y +++ N NY + K L Y +NY + +P Sbjct: 96 YKYNYNNN--NYNNNCKKLYYNINYIEQIP 123 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 22.6 bits (46), Expect = 3.6 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +1 Query: 55 YVFDFYNTRKNYMSVRKSLKYGLNYNDYVP 144 Y +++ N NY + K L Y +NY + +P Sbjct: 96 YKYNYNNN--NYNNNCKKLYYNINYIEQIP 123 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 22.6 bits (46), Expect = 3.6 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +1 Query: 55 YVFDFYNTRKNYMSVRKSLKYGLNYNDYVP 144 Y +++ N NY + K L Y +NY + +P Sbjct: 96 YKYNYNNN--NYNNNCKKLYYNINYIEQIP 123 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 22.6 bits (46), Expect = 3.6 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +2 Query: 287 NFGNRYSDMXNKRTESTRSKLSXII 361 NF N+Y EST +K++ I+ Sbjct: 105 NFANKYCGNITLNIESTSNKMTVIL 129 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 22.6 bits (46), Expect = 3.6 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -3 Query: 111 KTLPDGHIVFTSIIK 67 K LPDG +V TS+ K Sbjct: 566 KVLPDGTLVITSVQK 580 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 22.6 bits (46), Expect = 3.6 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -3 Query: 111 KTLPDGHIVFTSIIK 67 K LPDG +V TS+ K Sbjct: 566 KVLPDGTLVITSVQK 580 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 22.2 bits (45), Expect = 4.8 Identities = 7/22 (31%), Positives = 11/22 (50%) Frame = -1 Query: 368 SIELXSLVWILCSRFACYXYHC 303 S+ +W+ CS F +HC Sbjct: 408 SVNAGMWMWLSCSSFFQQFFHC 429 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 22.2 bits (45), Expect = 4.8 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = -1 Query: 440 PRCSLPNYPVFFSVNVAPKSLLY 372 P C P +FF++ + K+L Y Sbjct: 216 PCCDEPYPDIFFNITLRRKTLFY 238 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +1 Query: 85 NYMSVRKSLKYGLNYNDYVP 144 NY + K L Y +NY + +P Sbjct: 326 NYNNNYKPLHYNINYIEQIP 345 >DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +1 Query: 85 NYMSVRKSLKYGLNYNDYVP 144 NY + K L Y +NY + +P Sbjct: 93 NYNNNYKPLYYNINYIEQIP 112 >DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +1 Query: 85 NYMSVRKSLKYGLNYNDYVP 144 NY + K L Y +NY + +P Sbjct: 93 NYNNNYKPLYYNINYIEQIP 112 >DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +1 Query: 85 NYMSVRKSLKYGLNYNDYVP 144 NY + K L Y +NY + +P Sbjct: 93 NYNNNYKPLYYNINYIEQIP 112 >DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +1 Query: 85 NYMSVRKSLKYGLNYNDYVP 144 NY + K L Y +NY + +P Sbjct: 93 NYNNNYKPLYYNINYIEQIP 112 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +1 Query: 85 NYMSVRKSLKYGLNYNDYVP 144 NY + K L Y +NY + +P Sbjct: 326 NYNNNYKPLYYNINYIEQIP 345 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +1 Query: 85 NYMSVRKSLKYGLNYNDYVP 144 NY + K L Y +NY + +P Sbjct: 326 NYNNNYKPLYYNINYIEQIP 345 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +1 Query: 85 NYMSVRKSLKYGLNYNDYVP 144 NY + K L Y +NY + +P Sbjct: 326 NYNNNYKPLYYNINYIEQIP 345 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +1 Query: 85 NYMSVRKSLKYGLNYNDYVP 144 NY + K L Y +NY + +P Sbjct: 315 NYNNNYKPLYYNINYIEQIP 334 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,121 Number of Sequences: 438 Number of extensions: 3816 Number of successful extensions: 24 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21073995 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -