BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0153 (689 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g45510.1 68418.m05590 leucine-rich repeat family protein cont... 27 8.9 >At5g45510.1 68418.m05590 leucine-rich repeat family protein contains leucine rich repeat (LRR) domains, Pfam:PF00560 Length = 1222 Score = 27.5 bits (58), Expect = 8.9 Identities = 17/45 (37%), Positives = 20/45 (44%) Frame = +2 Query: 458 ITCDRKNYSYPKLITTNLKNFEKLYPRIIIIKDRHN*LFRPQPFT 592 IT N S L + NLK E L+ + KD N F P P T Sbjct: 340 ITFQTTNESQDLLESFNLKEAEALFTSSMFFKDMPNFFFDPVPGT 384 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,944,851 Number of Sequences: 28952 Number of extensions: 240819 Number of successful extensions: 388 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 385 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 388 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1467502800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -