BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0152 (704 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL021487-13|CAA16356.3| 326|Caenorhabditis elegans Hypothetical... 30 1.9 AC006730-11|ABO16462.1| 327|Caenorhabditis elegans Hypothetical... 30 1.9 >AL021487-13|CAA16356.3| 326|Caenorhabditis elegans Hypothetical protein Y45F10B.5 protein. Length = 326 Score = 29.9 bits (64), Expect = 1.9 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = -1 Query: 215 IYVPAKLITFCLKTARVDIPTSSQFQFIANYSIFKTVGTTK 93 +Y P K C KT + IP + FI +S+ VGT + Sbjct: 139 LYYPQKHNEVCAKTIKFAIPFIYLYPFIFGFSLIPAVGTCR 179 >AC006730-11|ABO16462.1| 327|Caenorhabditis elegans Hypothetical protein Y27F2A.11 protein. Length = 327 Score = 29.9 bits (64), Expect = 1.9 Identities = 14/48 (29%), Positives = 24/48 (50%) Frame = -1 Query: 272 VGRVLVAFNANKNLCYKNYIYVPAKLITFCLKTARVDIPTSSQFQFIA 129 + L FN K L + Y PA ++ +R+ +P S +F+F+A Sbjct: 136 IAGTLKKFNIPKYLLILMFAYFPAYTVSVASIYSRLSVPESLKFEFVA 183 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,518,568 Number of Sequences: 27780 Number of extensions: 359865 Number of successful extensions: 679 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 662 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 679 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1634564590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -