BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0151 (672 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC024799-8|AAW88387.1| 297|Caenorhabditis elegans Hypothetical ... 31 0.75 Z73424-1|CAA97779.1| 386|Caenorhabditis elegans Hypothetical pr... 29 3.0 >AC024799-8|AAW88387.1| 297|Caenorhabditis elegans Hypothetical protein Y49C4A.2 protein. Length = 297 Score = 31.1 bits (67), Expect = 0.75 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 2/61 (3%) Frame = +2 Query: 20 CARHSRLLSSFNYI*STSNYCINNTKMFH--IIFTT*NDLVIIMVALLYFINSKQATISN 193 C+ + S+ + N C N+ H IIFTT L I++ A L+ +N Q ++N Sbjct: 145 CSYQMEIPSTCRFFGCAINTCFNSFWSVHRTIIFTTIVILSILLAAKLFILNHFQLGVTN 204 Query: 194 K 196 K Sbjct: 205 K 205 >Z73424-1|CAA97779.1| 386|Caenorhabditis elegans Hypothetical protein C44B9.2 protein. Length = 386 Score = 29.1 bits (62), Expect = 3.0 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +2 Query: 374 KCPCILQSCTLIYQESSSPYLTLCLLGSLLKFNVQSG 484 KC ++Q Y++ LT+ + G LLK+N QSG Sbjct: 278 KCEAVMQQAQ--YEKHPDGLLTVHINGMLLKYNTQSG 312 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,193,357 Number of Sequences: 27780 Number of extensions: 246538 Number of successful extensions: 489 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 479 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 489 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1518563232 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -