BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0151 (672 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 27 0.21 AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. 23 3.5 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 22 6.1 DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 22 6.1 Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 21 8.1 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 26.6 bits (56), Expect = 0.21 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +2 Query: 377 CPCILQSCTLIYQESSSPYLTLCLLGSLLKF 469 CP IL SC IY +S + LC+ G L + Sbjct: 176 CPLILGSCKCIYVQS----INLCMAGRLFGY 202 >AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. Length = 355 Score = 22.6 bits (46), Expect = 3.5 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = -3 Query: 148 YHDNDKVVLRCENNVKHLGIVDAVITGRL 62 YH++DK L N HL I+ + G L Sbjct: 210 YHNDDKTFLVWCNEEDHLRIISMQMGGDL 238 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +1 Query: 379 SLYSPIVYLNLPRVFFPLSHIMPPWV 456 S+ +V LN+ P +H+M PWV Sbjct: 317 SICVTVVVLNV-HFRSPQTHVMAPWV 341 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 21.8 bits (44), Expect = 6.1 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +3 Query: 465 NSTSNLEGLFMFLRLHLFY 521 N N G +MF LHL Y Sbjct: 37 NLLKNRTGRYMFTYLHLLY 55 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 21.4 bits (43), Expect = 8.1 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +1 Query: 358 TWPCYEMSLYSPIVY 402 TW Y S ++PI+Y Sbjct: 311 TWLGYSNSAFNPIIY 325 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,435 Number of Sequences: 438 Number of extensions: 3241 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20343105 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -