BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0150 (706 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q8IER2 Cluster: Putative uncharacterized protein MAL13P... 33 6.8 UniRef50_Q9ZLJ9 Cluster: Putative; n=4; Helicobacter|Rep: Putati... 33 9.0 >UniRef50_Q8IER2 Cluster: Putative uncharacterized protein MAL13P1.27; n=2; Plasmodium|Rep: Putative uncharacterized protein MAL13P1.27 - Plasmodium falciparum (isolate 3D7) Length = 2295 Score = 33.1 bits (72), Expect = 6.8 Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Frame = -1 Query: 256 ILQSALRLLNEVSIKFRLPLIT-NLRIDSIRSHNDICILKNIYLFVCAF 113 +++ L + +K LP+I NL+ SI+S N I L +YL +C + Sbjct: 1855 VIEDILNDIGPYGMKKMLPMIILNLKTSSIKSKNIISYLDTLYLIICKY 1903 >UniRef50_Q9ZLJ9 Cluster: Putative; n=4; Helicobacter|Rep: Putative - Helicobacter pylori J99 (Campylobacter pylori J99) Length = 150 Score = 32.7 bits (71), Expect = 9.0 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +1 Query: 280 SLFDVRITCFVNRYENINGYGNIK*FY 360 ++ DVR T +NR+ N N YG++ FY Sbjct: 69 AIIDVRTTPLINRFTNYNAYGSLNGFY 95 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 661,555,656 Number of Sequences: 1657284 Number of extensions: 12680698 Number of successful extensions: 22563 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 21984 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22561 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 56198352344 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -