BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0150 (706 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 22 4.2 AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory recept... 22 4.2 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 22.2 bits (45), Expect = 4.2 Identities = 16/53 (30%), Positives = 23/53 (43%) Frame = -1 Query: 316 YSQNK*YERQKDCVCMTHTRILQSALRLLNEVSIKFRLPLITNLRIDSIRSHN 158 Y Q ++ K C T SAL L + + F +PLI L + I + N Sbjct: 211 YKQLDYFDGSKVPACHTLANTFWSALYFLTIIFLFFIIPLIILLILYCIIAKN 263 >AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory receptor candidate 15 protein. Length = 455 Score = 22.2 bits (45), Expect = 4.2 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +1 Query: 274 IRSLFDVRITCFVNRYENINGYGNIK 351 IR LFDV + Y+N+ + NI+ Sbjct: 315 IRILFDVSSEIYNVEYKNVEFWRNIR 340 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,906 Number of Sequences: 336 Number of extensions: 3677 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18634795 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -