BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0150 (706 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_53348| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_52559| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 >SB_53348| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 29.9 bits (64), Expect = 2.1 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 432 RYRYRDGTYPCRLTRRPATGGCILVELFYVSITVNILVP 316 R ++ PC + + P C + L YV T+N+ +P Sbjct: 32 RISLQENEIPCNIAQLPRFTNCAIERLMYVERTINVNLP 70 >SB_52559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 28.3 bits (60), Expect = 6.4 Identities = 23/82 (28%), Positives = 35/82 (42%), Gaps = 1/82 (1%) Frame = -2 Query: 498 VLGLNFAVQQLPSNRNALLLHGRYRYRDGTYPCRLTRRPATGGCILVELFYVSITVN-IL 322 V G + Q+ + +GRY D T+PC + GG ++ V V L Sbjct: 4 VKGFRYCALQINDQCHCGNSYGRYGKGDCTHPCEGSPDLKCGGTWRNSVYAVEAEVKPPL 63 Query: 321 VPIHKTSNTNVKKTAYV*RTHV 256 P H+ TN + +A + R HV Sbjct: 64 QPGHEYMYTNPQGSAPLTRDHV 85 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,475,076 Number of Sequences: 59808 Number of extensions: 428615 Number of successful extensions: 734 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 673 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 733 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1853669818 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -