BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0150 (706 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF495911-1|AAN60443.1| 6884|Homo sapiens nesprin-2 protein. 31 3.0 AF435011-1|AAL33548.1| 6885|Homo sapiens NUANCE protein. 31 3.0 >AF495911-1|AAN60443.1| 6884|Homo sapiens nesprin-2 protein. Length = 6884 Score = 31.5 bits (68), Expect = 3.0 Identities = 12/35 (34%), Positives = 23/35 (65%) Frame = -1 Query: 253 LQSALRLLNEVSIKFRLPLITNLRIDSIRSHNDIC 149 L+++L +LN++ + + PL+ NL I I++ D C Sbjct: 3157 LETSLHVLNQIKSQLQQPLLINLEIKHIQNEKDNC 3191 >AF435011-1|AAL33548.1| 6885|Homo sapiens NUANCE protein. Length = 6885 Score = 31.5 bits (68), Expect = 3.0 Identities = 12/35 (34%), Positives = 23/35 (65%) Frame = -1 Query: 253 LQSALRLLNEVSIKFRLPLITNLRIDSIRSHNDIC 149 L+++L +LN++ + + PL+ NL I I++ D C Sbjct: 3158 LETSLHVLNQIKSQLQQPLLINLEIKHIQNEKDNC 3192 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 96,668,808 Number of Sequences: 237096 Number of extensions: 1937984 Number of successful extensions: 2990 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2916 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2990 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8175213644 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -