BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0150 (706 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M63711-1|AAA28542.1| 1043|Drosophila melanogaster FTZ-F1 protein. 29 8.1 AE014296-3055|AAF49231.2| 1027|Drosophila melanogaster CG4059-PB... 29 8.1 >M63711-1|AAA28542.1| 1043|Drosophila melanogaster FTZ-F1 protein. Length = 1043 Score = 28.7 bits (61), Expect = 8.1 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = -2 Query: 393 TRRPATGGCILVELFYVSITVNILVPIHKTSN 298 T RP+ G +++E + NIL P H+++N Sbjct: 176 TVRPSNGNSVIIESVTMPSFANILFPTHRSAN 207 >AE014296-3055|AAF49231.2| 1027|Drosophila melanogaster CG4059-PB, isoform B protein. Length = 1027 Score = 28.7 bits (61), Expect = 8.1 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = -2 Query: 393 TRRPATGGCILVELFYVSITVNILVPIHKTSN 298 T RP+ G +++E + NIL P H+++N Sbjct: 174 TVRPSNGNSVIIESVTMPSFANILFPTHRSAN 205 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 30,345,825 Number of Sequences: 53049 Number of extensions: 617835 Number of successful extensions: 1029 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1011 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1029 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3108380451 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -