BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0149 (659 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. 136 2e-34 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 23 3.4 L10430-1|AAA27731.1| 150|Apis mellifera transposase protein. 22 4.5 AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase pr... 22 6.0 >AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. Length = 133 Score = 136 bits (329), Expect = 2e-34 Identities = 62/67 (92%), Positives = 65/67 (97%) Frame = +2 Query: 53 EMATAAASTSLEKSYELPXGQVITIGNERFRCPEALFQPSFLGMESCGIHETVYNSIMKC 232 EMATAA+S+SLEKSYELP GQVITIGNERFRCPEALFQPSFLGME+CGIHET YNSIMKC Sbjct: 1 EMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKC 60 Query: 233 DVDIRKD 253 DVDIRKD Sbjct: 61 DVDIRKD 67 Score = 134 bits (323), Expect = 9e-34 Identities = 62/65 (95%), Positives = 65/65 (100%) Frame = +1 Query: 256 YANTVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQ 435 YANTV+SGGTTMYPGIADRMQKEITALAPST+KIKIIAPPE+KYSVWIGGSILASLSTFQ Sbjct: 69 YANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPEKKYSVWIGGSILASLSTFQ 128 Query: 436 QMWIS 450 QMWIS Sbjct: 129 QMWIS 133 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 22.6 bits (46), Expect = 3.4 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = -1 Query: 623 DGVRLDVQFSGITRYNVLTVAFRTRTSTTPHSTGFT 516 D +LD F T+ N + ++ R++ STT G T Sbjct: 354 DSAKLDKIFDIATKENAMLLSGRSQKSTTGPPPGPT 389 >L10430-1|AAA27731.1| 150|Apis mellifera transposase protein. Length = 150 Score = 22.2 bits (45), Expect = 4.5 Identities = 10/32 (31%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = -3 Query: 246 RMSTSHFMMELYT--VSWMPHDSIPRKEGWKR 157 R F+ L T W+ +++I RK W R Sbjct: 18 RSENDPFLKRLITGDEKWVVYNNIKRKRSWSR 49 >AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase protein. Length = 342 Score = 21.8 bits (44), Expect = 6.0 Identities = 10/32 (31%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = -3 Query: 246 RMSTSHFMMELYT--VSWMPHDSIPRKEGWKR 157 R F+ L T W+ +++I RK W R Sbjct: 139 RNENDPFLKRLITGDEKWVVYNNIKRKRSWSR 170 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 161,965 Number of Sequences: 438 Number of extensions: 3246 Number of successful extensions: 16 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19855845 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -