BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0148 (661 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC30D11.04c |nup124||nucleoporin Nup124|Schizosaccharomyces po... 29 0.45 SPCC1620.08 |||succinate-CoA ligase |Schizosaccharomyces pombe|c... 25 9.7 >SPAC30D11.04c |nup124||nucleoporin Nup124|Schizosaccharomyces pombe|chr 1|||Manual Length = 1159 Score = 29.5 bits (63), Expect = 0.45 Identities = 17/50 (34%), Positives = 23/50 (46%) Frame = -1 Query: 235 IHPITLALDALRSNTRSKDPGNRTRRTRQRVQPNLKISPLSFSPDLLNGS 86 +HP T LD S T SKD + T+ + P L L SP ++ S Sbjct: 41 LHPFTSGLDEKASGTASKDRKSGRAGTKSLLTPELTPHYLGKSPRIIRVS 90 >SPCC1620.08 |||succinate-CoA ligase |Schizosaccharomyces pombe|chr 3|||Manual Length = 433 Score = 25.0 bits (52), Expect = 9.7 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 2/36 (5%) Frame = -2 Query: 471 LLTRSAHT*TP--FNPYKPGRNVDLHNDLSLESIRK 370 +LTRS P F+P+ RN+ LH +S + +RK Sbjct: 1 MLTRSVLRKAPRAFSPFLQKRNLALHEYISHDILRK 36 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,494,376 Number of Sequences: 5004 Number of extensions: 45808 Number of successful extensions: 90 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 89 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 90 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 299817502 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -