BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0147 (695 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 22 4.2 AM712905-1|CAN84644.1| 102|Tribolium castaneum hypothetical pro... 22 4.2 AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory recept... 22 5.5 AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. 21 9.6 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 9.6 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 9.6 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 9.6 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 9.6 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 22.2 bits (45), Expect = 4.2 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = -1 Query: 632 SWIVQFEGPQEITRVLELFSNSE 564 SW+ F+G ITR + + S+ Sbjct: 915 SWVAPFDGNSPITRYMIEYKQSK 937 >AM712905-1|CAN84644.1| 102|Tribolium castaneum hypothetical protein protein. Length = 102 Score = 22.2 bits (45), Expect = 4.2 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 470 LSLANPRLYTNSRTLF 423 LS A PRL N+RT+F Sbjct: 87 LSSAFPRLKRNARTIF 102 >AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory receptor candidate 5 protein. Length = 522 Score = 21.8 bits (44), Expect = 5.5 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = +2 Query: 218 WQLLRSRGSQIGIVIRIRGINQVSPKSVKLXNCLD 322 W LL + G I V R ++SP + + CLD Sbjct: 37 WILLFTLGVTISGVYRTDFYKKLSPMRLIVQTCLD 71 >AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. Length = 253 Score = 21.0 bits (42), Expect = 9.6 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = +1 Query: 268 PWYQPSFTEVRKVXQLFRLRQXNNG 342 P QP+ R + R++Q NNG Sbjct: 80 PQQQPASVARRNARERNRVKQVNNG 104 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.0 bits (42), Expect = 9.6 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = -3 Query: 282 WLIPRIRMTMPIWLPR 235 WL+ + +T+ IW P+ Sbjct: 470 WLLSQTWITLHIWTPK 485 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.0 bits (42), Expect = 9.6 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = -3 Query: 282 WLIPRIRMTMPIWLPR 235 WL+ + +T+ IW P+ Sbjct: 470 WLLSQTWITLHIWTPK 485 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.0 bits (42), Expect = 9.6 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = -3 Query: 282 WLIPRIRMTMPIWLPR 235 WL+ + +T+ IW P+ Sbjct: 470 WLLSQTWITLHIWTPK 485 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.0 bits (42), Expect = 9.6 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = -3 Query: 282 WLIPRIRMTMPIWLPR 235 WL+ + +T+ IW P+ Sbjct: 470 WLLSQTWITLHIWTPK 485 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,728 Number of Sequences: 336 Number of extensions: 3916 Number of successful extensions: 14 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18322480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -