BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0145 (662 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 23 1.7 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 23 1.7 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 23 1.7 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 23 1.7 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 5.2 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 5.2 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 5.2 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 5.2 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 22 5.2 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 21 6.8 AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory recept... 21 6.8 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 23.4 bits (48), Expect = 1.7 Identities = 7/30 (23%), Positives = 15/30 (50%) Frame = -1 Query: 458 SSNAFRFEGWGSRCNYTETLEFISQSGWRI 369 + N+ ++ G Y E +E + GW++ Sbjct: 284 AGNSGKYTGEAGMLGYNEIVELQKEGGWKV 313 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 23.4 bits (48), Expect = 1.7 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 247 IKSLSFQCSYKFFFYCLDG 303 +K L+F C+ FYC +G Sbjct: 62 VKCLAFFCTALVIFYCQEG 80 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 23.4 bits (48), Expect = 1.7 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 247 IKSLSFQCSYKFFFYCLDG 303 +K L+F C+ FYC +G Sbjct: 295 VKCLAFFCTALVIFYCQEG 313 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 23.4 bits (48), Expect = 1.7 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 247 IKSLSFQCSYKFFFYCLDG 303 +K L+F C+ FYC +G Sbjct: 295 VKCLAFFCTALVIFYCQEG 313 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.8 bits (44), Expect = 5.2 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -1 Query: 143 KILGITNEILKIRFYLLNNIIYL 75 K L IT +ILKI YL+ +I L Sbjct: 61 KCLEITVKILKIVAYLVTFVIVL 83 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.8 bits (44), Expect = 5.2 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -1 Query: 143 KILGITNEILKIRFYLLNNIIYL 75 K L IT +ILKI YL+ +I L Sbjct: 61 KCLEITVKILKIVAYLVTFVIVL 83 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.8 bits (44), Expect = 5.2 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -1 Query: 143 KILGITNEILKIRFYLLNNIIYL 75 K L IT +ILKI YL+ +I L Sbjct: 61 KCLEITVKILKIVAYLVTFVIVL 83 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.8 bits (44), Expect = 5.2 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -1 Query: 143 KILGITNEILKIRFYLLNNIIYL 75 K L IT +ILKI YL+ +I L Sbjct: 61 KCLEITVKILKIVAYLVTFVIVL 83 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 21.8 bits (44), Expect = 5.2 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -1 Query: 125 NEILKIRFYLLNNII 81 N ILK RF +NNI+ Sbjct: 194 NVILKTRFKTINNIL 208 Score = 21.4 bits (43), Expect = 6.8 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +2 Query: 59 IVNVVLNR*YYLINKIL 109 + N++L R + LIN IL Sbjct: 474 VANIILRRRFALINSIL 490 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 21.4 bits (43), Expect = 6.8 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = -1 Query: 245 FIPIQQYL*FSNTKIIKFD*WRIHIA 168 F PI L FS TK++ F + IA Sbjct: 700 FFPIDYSLVFSETKLLLFKITSVMIA 725 >AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory receptor candidate 31 protein. Length = 250 Score = 21.4 bits (43), Expect = 6.8 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +2 Query: 512 HTTSNYANYYFADLIFITRCY 574 HTTSN +FA + +CY Sbjct: 31 HTTSNKQLQFFAVEHLLIQCY 51 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,113 Number of Sequences: 336 Number of extensions: 3842 Number of successful extensions: 16 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17177325 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -