BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0144 (705 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U74667-1|AAB18236.1| 513|Homo sapiens tat interactive protein p... 32 1.7 U40989-1|AAB02683.1| 482|Homo sapiens tat interactive protein p... 32 1.7 BC117167-1|AAI17168.1| 513|Homo sapiens HIV-1 Tat interacting p... 32 1.7 BC064912-1|AAH64912.1| 513|Homo sapiens HIV-1 Tat interacting p... 32 1.7 AY214165-1|AAO21130.1| 513|Homo sapiens HIV-1 Tat interactive p... 32 1.7 >U74667-1|AAB18236.1| 513|Homo sapiens tat interactive protein protein. Length = 513 Score = 32.3 bits (70), Expect = 1.7 Identities = 16/44 (36%), Positives = 20/44 (45%) Frame = +3 Query: 171 AMPGAEPSHCLPQPSCYLPLHRKLTTQESCFANETTTGSESRPA 302 A+PG EP L SC P HR + + T SE+ PA Sbjct: 124 AIPGGEPDQPLSSSSCLQPNHRSTKRKVEVVSPATPVPSETAPA 167 >U40989-1|AAB02683.1| 482|Homo sapiens tat interactive protein protein. Length = 482 Score = 32.3 bits (70), Expect = 1.7 Identities = 16/44 (36%), Positives = 20/44 (45%) Frame = +3 Query: 171 AMPGAEPSHCLPQPSCYLPLHRKLTTQESCFANETTTGSESRPA 302 A+PG EP L SC P HR + + T SE+ PA Sbjct: 93 AIPGGEPDQPLSSSSCLQPNHRSTKRKVEVVSPATPVPSETAPA 136 >BC117167-1|AAI17168.1| 513|Homo sapiens HIV-1 Tat interacting protein, 60kDa protein. Length = 513 Score = 32.3 bits (70), Expect = 1.7 Identities = 16/44 (36%), Positives = 20/44 (45%) Frame = +3 Query: 171 AMPGAEPSHCLPQPSCYLPLHRKLTTQESCFANETTTGSESRPA 302 A+PG EP L SC P HR + + T SE+ PA Sbjct: 124 AIPGGEPDQPLSSSSCLQPNHRSTKRKVEVVSPATPVPSETAPA 167 >BC064912-1|AAH64912.1| 513|Homo sapiens HIV-1 Tat interacting protein, 60kDa protein. Length = 513 Score = 32.3 bits (70), Expect = 1.7 Identities = 16/44 (36%), Positives = 20/44 (45%) Frame = +3 Query: 171 AMPGAEPSHCLPQPSCYLPLHRKLTTQESCFANETTTGSESRPA 302 A+PG EP L SC P HR + + T SE+ PA Sbjct: 124 AIPGGEPDQPLSSSSCLQPNHRSTKRKVEVVSPATPVPSETAPA 167 >AY214165-1|AAO21130.1| 513|Homo sapiens HIV-1 Tat interactive protein, 60kDa protein. Length = 513 Score = 32.3 bits (70), Expect = 1.7 Identities = 16/44 (36%), Positives = 20/44 (45%) Frame = +3 Query: 171 AMPGAEPSHCLPQPSCYLPLHRKLTTQESCFANETTTGSESRPA 302 A+PG EP L SC P HR + + T SE+ PA Sbjct: 124 AIPGGEPDQPLSSSSCLQPNHRSTKRKVEVVSPATPVPSETAPA 167 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 100,413,431 Number of Sequences: 237096 Number of extensions: 2095131 Number of successful extensions: 8192 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8036 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8192 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8175213644 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -