BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0143 (694 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17227| Best HMM Match : KE2 (HMM E-Value=4.1) 29 2.7 SB_27386| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_11257| Best HMM Match : GCC2_GCC3 (HMM E-Value=2.7e-11) 28 6.2 SB_9280| Best HMM Match : 7tm_1 (HMM E-Value=0.0027) 28 8.3 >SB_17227| Best HMM Match : KE2 (HMM E-Value=4.1) Length = 162 Score = 29.5 bits (63), Expect = 2.7 Identities = 16/33 (48%), Positives = 19/33 (57%) Frame = +1 Query: 58 GTSP*RPVTGLKSVFPAVMKCPSARTTWSLPRK 156 G P + + GLK P KCPS+R T SLP K Sbjct: 14 GAEPSKNLPGLKPS-PKKRKCPSSRRTVSLPPK 45 >SB_27386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 501 Score = 28.3 bits (60), Expect = 6.2 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = -1 Query: 478 NSFHDHPEDRIAETGSVHVQGSRHVGVLVHVVLAI 374 ++ H HPED + + GSV++ L V+A+ Sbjct: 56 STHHQHPEDLVYDAGSVYLGTKTSPASLARAVMAV 90 >SB_11257| Best HMM Match : GCC2_GCC3 (HMM E-Value=2.7e-11) Length = 3810 Score = 28.3 bits (60), Expect = 6.2 Identities = 14/40 (35%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = -3 Query: 311 LGHRGPDGRG--FQCPQTSSGYNSAVTTLDLSSKDTLSDH 198 +GH PDG G + CP+ + G ++A T+D T H Sbjct: 1142 VGHYCPDGTGEPYNCPKGTFGNDTAYKTVDECWNCTAGQH 1181 >SB_9280| Best HMM Match : 7tm_1 (HMM E-Value=0.0027) Length = 292 Score = 27.9 bits (59), Expect = 8.3 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +1 Query: 343 LDQLDEENAELWPIQHGQVHLRADFLGHV 429 L LD A +WP++H Q+H R ++ V Sbjct: 118 LISLDRMFATVWPLRHRQIHPRMYYISSV 146 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,047,144 Number of Sequences: 59808 Number of extensions: 455494 Number of successful extensions: 1191 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1108 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1191 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1805522550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -