BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0143 (694 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81512-3|CAE46668.1| 3175|Caenorhabditis elegans Hypothetical pr... 29 4.2 Z81512-2|CAB04172.2| 3184|Caenorhabditis elegans Hypothetical pr... 29 4.2 AC006655-6|AAF39878.2| 383|Caenorhabditis elegans Hypothetical ... 29 4.2 Z80344-8|CAB02490.2| 2268|Caenorhabditis elegans Hypothetical pr... 28 7.3 AL117203-22|CAB60425.1| 2268|Caenorhabditis elegans Hypothetical... 28 7.3 >Z81512-3|CAE46668.1| 3175|Caenorhabditis elegans Hypothetical protein F25C8.3b protein. Length = 3175 Score = 28.7 bits (61), Expect = 4.2 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -2 Query: 633 SRYIALLMSMLVLINECDQLIGGNFLHFD 547 S++I + + M LIN C+QL+ G FD Sbjct: 2452 SQWITMAVEMKALINSCEQLVRGPTRAFD 2480 >Z81512-2|CAB04172.2| 3184|Caenorhabditis elegans Hypothetical protein F25C8.3a protein. Length = 3184 Score = 28.7 bits (61), Expect = 4.2 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -2 Query: 633 SRYIALLMSMLVLINECDQLIGGNFLHFD 547 S++I + + M LIN C+QL+ G FD Sbjct: 2461 SQWITMAVEMKALINSCEQLVRGPTRAFD 2489 >AC006655-6|AAF39878.2| 383|Caenorhabditis elegans Hypothetical protein H10D18.6 protein. Length = 383 Score = 28.7 bits (61), Expect = 4.2 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +2 Query: 308 LEIVGDDAKVIHLTNLMKKMLSYGQYNMDKYTY 406 +E VG + H+T KM S+ +YN D Y Y Sbjct: 301 VEFVGKYGPLHHMTPYSLKMSSFQRYNYDIYVY 333 >Z80344-8|CAB02490.2| 2268|Caenorhabditis elegans Hypothetical protein F15D4.7 protein. Length = 2268 Score = 27.9 bits (59), Expect = 7.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +3 Query: 39 DVKPMMWNEPLETGYWPKIRLPSGD 113 + P++W EP TG KIR+P D Sbjct: 738 EADPIVWKEPAGTGSKMKIRVPPTD 762 >AL117203-22|CAB60425.1| 2268|Caenorhabditis elegans Hypothetical protein F15D4.7 protein. Length = 2268 Score = 27.9 bits (59), Expect = 7.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +3 Query: 39 DVKPMMWNEPLETGYWPKIRLPSGD 113 + P++W EP TG KIR+P D Sbjct: 738 EADPIVWKEPAGTGSKMKIRVPPTD 762 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,980,904 Number of Sequences: 27780 Number of extensions: 330266 Number of successful extensions: 999 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 933 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 999 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1592382278 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -