BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0139 (682 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 24 1.5 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 23 3.6 AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydroge... 22 6.2 AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor p... 21 8.2 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 21 8.2 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 23.8 bits (49), Expect = 1.5 Identities = 14/40 (35%), Positives = 17/40 (42%) Frame = +1 Query: 205 LLRERFYCFSNSNLVVLRVHSLEISTAIIWFILVTAASTW 324 L RE FYC + N R+ I I W V A + W Sbjct: 308 LWREFFYCAATKNPNFDRMQGNPICVQIPWDKNVEALAKW 347 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 22.6 bits (46), Expect = 3.6 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +2 Query: 41 VVLPLNSTQLLFVFVKVKVTYLV 109 +VLPL + LLF F+ V+ LV Sbjct: 291 LVLPLIAKYLLFTFIMNTVSILV 313 >AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydrogenase/reductase protein. Length = 246 Score = 21.8 bits (44), Expect = 6.2 Identities = 14/48 (29%), Positives = 24/48 (50%) Frame = +3 Query: 516 IFYNNALFLTIVILSSFYILRTFTPTVNYIVSLTAASGTSCSTLHRNQ 659 IF N L LT +I +++ IV++ ASG + ++RN+ Sbjct: 111 IFDINLLGLTCMIQEVLKLMKKKGINNGIIVNINDASGLNLLPMNRNR 158 >AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor protein. Length = 139 Score = 21.4 bits (43), Expect = 8.2 Identities = 13/43 (30%), Positives = 19/43 (44%) Frame = +1 Query: 157 IVARF*PECVHKIVCSLLRERFYCFSNSNLVVLRVHSLEISTA 285 +V F C+H V S+L YC S N + + S + A Sbjct: 30 LVRAFCRNCIHPTVFSVLFWLGYCNSAINPCIYALFSKDFRFA 72 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 21.4 bits (43), Expect = 8.2 Identities = 13/43 (30%), Positives = 19/43 (44%) Frame = +1 Query: 157 IVARF*PECVHKIVCSLLRERFYCFSNSNLVVLRVHSLEISTA 285 +V F C+H V S+L YC S N + + S + A Sbjct: 478 LVRAFCRNCIHPTVFSVLFWLGYCNSAINPCIYALFSKDFRFA 520 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,141 Number of Sequences: 438 Number of extensions: 4032 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20708550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -