BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0138 (665 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory recept... 23 2.2 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 22 5.2 DQ659252-1|ABG47450.1| 377|Tribolium castaneum chitinase 13 pro... 21 9.1 >AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory receptor candidate 60 protein. Length = 364 Score = 23.0 bits (47), Expect = 2.2 Identities = 8/30 (26%), Positives = 16/30 (53%) Frame = +1 Query: 415 SACLIIINDYLLYSCIHFS*IIIWTVYITF 504 + CL+ +N Y + + + I++ T I F Sbjct: 21 TVCLVPLNPYQFFLAVQYPRIVVSTFNIVF 50 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 21.8 bits (44), Expect = 5.2 Identities = 12/61 (19%), Positives = 30/61 (49%) Frame = +2 Query: 434 LMIICCIRVYILVK*LFGQYI*HLCMLLFKSILIYIFNF*MIVSLHNMVA*NIGWSYYVC 613 L+ + CI + +F ++ C+L+ + Y + ++ ++H ++ I + YY+ Sbjct: 206 LLFLPCIYYFYSAFIIFTIHLLFYCVLIILLCIYYFYYAFILFTVHLLLLVCIYYFYYMH 265 Query: 614 L 616 L Sbjct: 266 L 266 Score = 21.0 bits (42), Expect = 9.1 Identities = 7/20 (35%), Positives = 14/20 (70%) Frame = +2 Query: 218 FYNLSVLFLIINMQYCLIMI 277 FY+ ++F I + YC+++I Sbjct: 215 FYSAFIIFTIHLLFYCVLII 234 >DQ659252-1|ABG47450.1| 377|Tribolium castaneum chitinase 13 protein. Length = 377 Score = 21.0 bits (42), Expect = 9.1 Identities = 6/11 (54%), Positives = 10/11 (90%) Frame = -2 Query: 553 LKIKYIYKDTF 521 +K+ Y+Y+DTF Sbjct: 312 MKVPYMYEDTF 322 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 150,339 Number of Sequences: 336 Number of extensions: 3198 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17281430 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -